KEGG   Edwardsiella piscicida C07-087: ETAC_02860Help
Entry
ETAC_02860        CDS       T02509                                 

Definition
(GenBank) Dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00261  Monobactam biosynthesis
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_02860
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ETAC_02860
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     ETAC_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N
Motif
Other DBs
NCBI-ProteinID: AGH72705
Position
657494..658312
Genome map
AA seq 272 aa AA seqDB search
MAEQIRVAIAGAGGRMGRQLIAATAAIPGVTLGAALEREGSSLLGCDAGELAGCGITGVT
VESSLERVAGQFDVLIDFTRPEGTMAHLAFCQAHGKAMVIGTTGFSEQEKATIEAASQHI
AIVLAANFSVGVNVMLRLLEKAAQVMGSYCDIEILEAHHRHKVDAPSGTALAMGEAIAGA
LGRRLESCAVYTRQGHTGERVPGSIGFATLRAGDIVGEHTALFADVGERLEITHKASSRM
TFASGAMRAALWLGAQQPGMYDMCDVLALDTL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagattcgggtcgcgatcgccggtgccggcggtcgaatggggcgtcagctg
attgcggcgaccgcggcgatccccggcgtgacgctgggggcggcgctggagcgggagggc
tccagcctgctgggctgcgacgccggcgaactggcgggctgtggcataaccggtgtgacg
gtcgagtcatcgctggagcgggttgcggggcagtttgatgtcctgatcgactttacccgt
cccgagggaacgatggcgcatctggccttttgtcaggcgcacggtaaagcgatggtcatt
gggacgaccggcttcagcgagcaggaaaaggcgacgattgaggcggcttcacagcatatc
gctatcgttttggccgccaacttcagcgtgggggtgaacgtgatgttgcgtctgctggaa
aaggcggcgcaggtgatggggagctactgcgatattgaaattcttgaagcgcatcatcgc
cataaagtcgatgcgccatcggggacggcgctggcgatgggcgaggcgatcgccggtgcg
ttgggccgccgcctggaaagctgtgcggtctatactcgccagggacacaccggggagcgg
gttcctggcagcatcggtttcgcaacgctgcgcgccggcgatatcgtgggcgagcatacc
gccctgttcgccgatgttggcgagcgtctggagattacccataaggcgtcgagccgcatg
acctttgccagcggcgcaatgcgagcggcgctgtggctcggcgcgcagcagccggggatg
tacgatatgtgtgatgttttggctctcgacaccctataa

DBGET integrated database retrieval system