KEGG   Edwardsiella piscicida C07-087: ETAC_02940Help
Entry
ETAC_02940        CDS       T02509                                 

Gene name
thiQ
Definition
(GenBank) thiamine transporter ATP-binding subunit
  KO
K02062  thiamine transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00191  Thiamine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02940 (thiQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02940 (thiQ)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191]
    ETAC_02940 (thiQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 SbcCD_C AAA_25 AAA_29 RsgA_GTPase AAA_22 DUF87 AAA_23 NACHT AAA_30 Mg_chelatase MMR_HSR1 AAA_28 AAA_24 AAA_18 Cytidylate_kin IstB_IS21 Rad17
Motif
Other DBs
NCBI-ProteinID: AGH72721
Position
complement(679731..680444)
Genome map
AA seq 237 aa AA seqDB search
MIRLDNLLYRYQQQTLSFSLHAAAGERIAILGPSGAGKSTLLSLIAGFLAPSSGDLYLNG
IDCRCAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLDPGLRLDDDQRRRLADIAELVGIH
DYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPALRAEMLTLLDDVCRQRQ
LTLLMVSHNLDDAARIAPRTLVIDDGHIAYDGPTAALLTGSVAAARLLGRKVPEQAE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctggataatctgctctaccgctatcagcaacagaccctgagctttagcctg
cacgccgccgccggcgagcgcatcgccatcctggggccaagcggcgcagggaaaagtacc
ctattgagcctcatcgctggatttttggcgccgagcagcggcgatctgtacctcaacggc
atcgattgccgctgcgcacccccgtctcagcgcccggtatcgatgctgttccaggagcat
aacctgttcgcccacttgaccatcgcccaaaatctggggctggggctggatcccggactg
cggcttgacgacgaccagcgccgtcggctcgcggatatcgccgaactggtcggtattcac
gactacctgccgcggctccccggccagctctccggcggccaacgtcagcgggccgcgctg
gcgcgctgcctgctgcgccgtcagccgattttgctgctggatgagcccttctctgccctg
gatcccgccctgcgggccgaaatgctcacgctgctggatgatgtctgccgtcagcgacag
ctgaccctgctgatggtatcgcacaacctggacgatgcggcgcgcatcgcaccgcgtacc
ctggtgattgacgatggccatatcgcatacgacggccccaccgccgccctgctgaccggg
tcggtcgcggcggcgcgtctgctgggacgcaaggtgccagagcaggccgaatag

DBGET integrated database retrieval system