KEGG   Edwardsiella piscicida C07-087: ETAC_02950Help
Entry
ETAC_02950        CDS       T02509                                 

Definition
(GenBank) thiamin ABC transporter substrate-binding protein
  KO
K02064  thiamine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00191  Thiamine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02950
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191]
    ETAC_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGH72723
Position
complement(682024..683019)
Genome map
AA seq 331 aa AA seqDB search
MLKKLFSTLALLTASLLAQAADKPVLTVYTYDSFAADWGPGPKIKQAFEQSCHCELKLVP
LEDGVAILNRLRMEGKNSPADVVLGLDNNLLTAARHSGLFSPSQTDTRGLQIPGGWHDAN
FVPYDYGYFAFVYDRQRVNNPPTSLKQLVEGPEKWRVIYQDPRTSTPGLGLLLWMQKVYG
DQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTSPAYHQIEEHSDRYAAAMF
DEGHYLQVEVAGVLKHSPQPALAHQFMQFITTPAFQNAIPTGNWMYPTTAVALPPAFAAL
PKPQKTLSFTADDVAQHRAEWIRAWQSALSR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaaaaactgttttcgactctggccctactgacggcctcgctgctggcgcaggcg
gccgacaagcccgttctgaccgtctacacctatgactctttcgccgccgactggggaccc
gggcccaagatcaagcaggccttcgaacaatcctgccactgtgagctcaagctggtcccg
ctggaggacggcgtcgccatccttaaccgcctgcggatggaggggaaaaacagcccggcc
gacgtcgtgctggggctggataacaacctgctgaccgccgcccggcacagcgggctattc
agccccagccagacggacacccgcggactgcagatccccggcggctggcacgacgccaac
tttgtcccctatgactacggttatttcgcctttgtctatgaccgccagcgagttaacaat
ccgccgaccagcctgaaacagctggttgagggcccggaaaagtggcgcgtcatctatcag
gacccgcgcaccagcaccccggggcttggcctgctgctatggatgcagaaggtctacggg
gatcaggcgccagccgcctggcagaagctggcgcaaaagaccgtcaccgtcaccaaaggg
tggagcgaagcctatggcctgttcctcaaaggcgaagcggacatggtcctcagctatacc
acctcgccggcctaccaccagatcgaagagcacagcgatcgctatgccgcggcgatgttt
gacgaaggccactacctgcaggtcgaggtcgccggcgtactgaagcacagcccccagccg
gcgctggcgcaccagtttatgcagttcattaccaccccggcgttccaaaatgccatcccg
accggcaactggatgtatccgacgacagcggtggcgctaccgccggccttcgccgccctg
cccaagccgcagaagacgctcagctttaccgccgacgacgtcgcacagcaccgagctgag
tggatccgcgcatggcaaagcgccctgagccgctga

DBGET integrated database retrieval system