KEGG   Edwardsiella piscicida C07-087: ETAC_02965Help
Entry
ETAC_02965        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K18893  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02965
Transporters [BR:etc02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    ETAC_02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N MMR_HSR1 AAA_22 AAA_7 AAA_29 RsgA_GTPase AAA_24 AAA_30 AAA_16 DUF87 DUF4271
Motif
Other DBs
NCBI-ProteinID: AGH72726
Position
complement(686730..688559)
Genome map
AA seq 609 aa AA seqDB search
MFHWFERLTEPFPSPDPQKPPATLFGFCRHYTRGFERPLGAMALLSAAVAVCEVMLLRYL
GELVDLLSHAERATFWTDQRPSLIGMAILVLAVMPLLAWLHSNLLHQSILGNYPMAVRWQ
VHRYLLGQSIAFFQRDFAGRVATKVMQSAQSVREVVMKMVDLLIYILVYLISVLVMIASV
DTLLLIPLLLWLAAYILIQIRLLPRLRRIASEQANAQSVMSGTIVDTYTHITTVKLFSHD
QRESDYARHAMQRYLATVYRQMRTLTGLLFSVDVINYLLLFSLAALSIALWQQQAVSVGV
IAVGISLALRLQGMSKWIMWEVRALFESIGQVIDSIHTVANDIDVADKPGAVPLRLTRGE
IRFNAVGFGYPGGRTLFDRLDLHIRPGEKVAIVGRSGAGKSSLMHLLLRFYDLQSGSITL
DAQNIAEVTQASLRRQIGMITQDTALLHRSIRENLLYGNPQASEAEMIAACRRAEAHDFI
CQLADDTGQRGYDTQVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEAEAA
IQDNLAQMMAGKTVIAIAHRLSTIAAMDRLIVMDHGRIVAQGSHRELLRQNGIYARLWAH
QTGGFIGSD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattggttcgaacgactgacggagccgtttccgtcaccggatccccaaaagccg
ccggcgacactgttcggcttctgtcgccactacacccgcggttttgaacgtccgctcggc
gccatggcgctgctcagcgcggccgtcgccgtctgcgaagtcatgctgttacgctacctg
ggcgagctggtcgacctgcttagtcacgccgaacgcgccacgttctggaccgatcaacgc
cccagcctgatcggcatggcgattctggtgctggcggtcatgcccttactggcctggctg
cattcgaacctgctgcaccaaagtattctgggaaactaccccatggccgtccgttggcag
gtacaccgctatctcctcggccagagcatcgcgttttttcagcgtgatttcgccgggcga
gtggcgacaaaagtgatgcaaagcgcccaatcggtgcgcgaagtggtcatgaaaatggtc
gacctgctgatctatattctggtgtatctgatctcggtgctggtcatgatcgccagcgtc
gatacgctgctgctgatccccttactgctgtggctggcggcctatatcctgattcagatc
cgtctcctgccgcgtctgcggcgtatcgccagcgagcaggccaacgcgcagtccgtgatg
agcggcaccatcgtggacacctatacccacatcaccaccgtcaaactgttttcccatgac
cagcgcgaaagcgactatgcccgacacgctatgcagcgctatctggccacggtataccgt
cagatgcgtaccctgaccgggctgctgttcagcgtggatgtcatcaactatctgctgctg
ttctccctggcggcgctgtctatcgccctgtggcagcagcaggcggtcagcgtcggcgtc
atcgccgtcggcatcagtcttgccctgcgtctacagggcatgtccaagtggattatgtgg
gaggtacgcgcgctgtttgaaagcatcgggcaggtcatcgacagcatccataccgtcgcc
aacgacatcgacgtcgccgataaaccgggggctgtaccgctgcgcctgacgcgcggcgag
attcgttttaacgccgtcggctttggttaccccggcggacggacgctgttcgataggctg
gatctgcacatccgccccggtgaaaaggtcgccattgtcggccgctccggagccggaaag
tccagtttgatgcatctgctgctgcgcttttatgacctgcaatcgggcagcattaccctt
gatgcccagaacatcgcagaggttacgcaggcctctttacgccgacagataggcatgatc
acccaggataccgccctgctgcaccgctcaatccgcgaaaacctgctgtatggcaatccg
caggccagcgaggcggagatgatcgcggcctgccggcgggcggaggcgcatgactttatt
tgccaactggctgacgatacgggccagcgcggttatgacacccaggtcggcgagcgcggg
gtcaagctgtccggtggacagcgccagcgtatcgccatcgcccgggtcttgctcaaggat
gcgcccattctcatcatggacgaggcgacctccgcgctcgactccgaagccgaggccgcc
attcaggacaatctggcgcagatgatggccggaaaaacggtgatcgccatcgcgcaccgc
ctctcgaccatcgccgccatggatcgccttattgtcatggaccacgggcggatagtcgct
cagggcagtcatcgggagctgctgcggcaaaacggcatctatgcccggctgtgggctcac
cagaccggcggttttatcggcagcgactag

DBGET integrated database retrieval system