KEGG   Edwardsiella piscicida C07-087: ETAC_02970Help
Entry
ETAC_02970        CDS       T02509                                 

Definition
(GenBank) Ferrichrome transport ATP-binding protein FhuC
  KO
K10829  ferric hydroxamate transport system ATP-binding protein [EC:7.2.2.16]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02970
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.16  ABC-type ferric hydroxamate transporter
     ETAC_02970
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate transporter [MD:M00869]
    ETAC_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_16 AAA_30 AAA_29 AAA_23 AAA_15 RsgA_GTPase NACHT AAA_22 AAA_33 AAA_25 AAA_13 AAA_27 DUF2813 MeaB Zeta_toxin DUF87 DLIC
Motif
Other DBs
NCBI-ProteinID: AGH72727
Position
688671..689444
Genome map
AA seq 257 aa AA seqDB search
MFSLTNLEVVRGGREVLAIEHLTIPTDRLTVILGHNGSGKSTLVSLLAGQLRPDGGQIAL
DGQALSSLSAGALARRVAFLPQKLPASAGLTVRELVRLGRFPWRGMLGRWRREDRQLIDA
AMAETGVAPFADTLVDTLSGGERQRAWVAMLLAQASPLLILDEPTSALDIQHQYQLMALL
SALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGSAAALADEQRLSDLYQTPIRLTDH
PHPTPGAPPHKVAIICA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgctaaccaacctagaggttgtgcgcgggggacgcgaggtcctggctatcgaa
catttgacgatcccaacggatcgtctgacggtgattctgggacataacgggtccggtaaa
tcgacgctggtcagcctgctggccggtcagctgcgccccgacggcggccagatcgctctg
gatgggcaggcgctgtcatccctctccgccggcgcactggcgcggcgggtggcattttta
ccgcagaagctgcccgccagcgccgggctgaccgtgagagagctggtgcgcctgggccgc
tttccctggcgtggcatgctgggacgctggcgccgggaagatcggcagctcattgacgcg
gcgatggctgagactggggtggccccctttgccgatacgctggtggatacgctgtccggc
ggggaacgccagcgggcgtgggtcgccatgctgttggcgcaggcctccccgttgctgatc
ctcgatgagccgacctcggcgctggatatccagcaccagtaccaactcatggcgctgcta
tcggcgctgccgcgcggcgtcttggtcattctgcacgacctgaatctggcgctgcgctat
gccgatcacgtgatcgccctgaagcaggggcgcgtggcctttgctggctcggcggcggcg
ttggccgacgagcagcgactgtccgatctgtaccaaaccccgatccgcctgacggatcac
ccgcatcctacccccggggcgccgcctcataaagttgctatcatatgtgcttga

DBGET integrated database retrieval system