KEGG   Edwardsiella piscicida C07-087: ETAC_02975Help
Entry
ETAC_02975        CDS       T02509                                 

Definition
(GenBank) ferrichrome-binding periplasmic protein
  KO
K23227  ferric hydroxamate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02975
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate transporter [MD:M00869]
    ETAC_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 MEKHLA
Motif
Other DBs
NCBI-ProteinID: AGH72728
Position
689444..690367
Genome map
AA seq 307 aa AA seqDB search
MFNFIFRFFAPLALLISLFSFSAQALTVSDSRGTHQLPAVPTRAVVLDWDLLEQTIELGV
TPLAATDLDSYREWVAQPLIPAQTQSVGSREEPNLERIAALKPDVILASEMQQALLPRLT
QIAPVLYYTNFSAADDHAAVAIMQFRQLAQVFGREAIAEQKLAAMQARFQHLSRALREAF
HGQLPAVTVMRFASTTSTYLYTSNAMPVYVLRQLGITPALAPPPARWGIVQQPIAGLQRV
GQGYVLYFLPFHDAARLDATRLWQAMPFVRGQRVSAVRPVWSYGGAMSLQYAAEAMAESL
MALAAQK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattttatttttagattttttgcgccattggcgctgctgatctccctgttctcg
ttcagcgcgcaagcgctgacggtcagcgacagccgcggtactcatcagctacctgccgtg
ccgacgcgggccgtggtgctggactgggatctgctggagcagaccatcgagctgggggtg
acgccgctggccgccaccgatctggacagctaccgcgaatgggtggcacagccgctgatc
ccggcgcagacgcagagcgtcggcagccgagaagagccgaatctggagcgcatcgcggcg
ctgaaacccgatgtgatcctcgcgagcgaaatgcagcaggcgctgctgccgcgcctgacg
cagattgcaccggtgctgtactacaccaatttttccgccgcggacgatcacgccgcggtg
gcgataatgcagttccgccagctggcgcaggtgtttggtcgtgaggcgattgcggaacag
aagctggccgcgatgcaggctcgctttcagcatttatcacgggcgctgcgcgaggcgttt
catggccagctccccgccgtcacggtgatgcgctttgccagcacgacctcaacctacctg
tacacctccaacgctatgccggtctatgtcctgcgccagctggggatcacgcccgctctg
gcgccgccgccggcgcgctgggggattgtccagcagccgatcgctgggctacagcgggtc
ggtcaaggctacgtgctttactttctgccttttcatgacgctgcgcgcctggacgcgacg
cgactatggcaggcgatgccgtttgttcgcgggcagcgggtgagcgccgtccgtccggtc
tggagctatggcggcgcgatgtcattacagtatgccgcagaggcgatggcggaaagcctg
atggcgctggcggcgcagaaatga

DBGET integrated database retrieval system