KEGG   Edwardsiella piscicida C07-087: ETAC_02995Help
Entry
ETAC_02995        CDS       T02509                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_02995
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_02995
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ETAC_02995
    4.2.1.35  (R)-2-methylmalate dehydratase
     ETAC_02995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AGH72730
Position
complement(694677..695279)
Genome map
AA seq 200 aa AA seqDB search
MTEFTRHTGIVVPLNAANVDTDAIIPKQFLQKVTRSGFGRHLFHDWRFLDAAGEQPNPAF
VLNQPPFQQGSILLARENFGCGSSREHAPWALTDYGFRVVIAPSFADIFYGNAFNSQLLP
IILDEAQIATLFALVGASPGIAFSVDVEQQTLQAGDACYTFTLDPFRRHCLIHGLDGIGL
TLRQASAIADYEARRPAFLR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactgagttcacccgccataccggcatcgtcgtcccgctgaacgccgccaacgtggat
accgatgccattattcccaagcaatttctgcagaaggtgacccgcagtggctttggacgc
cacctgtttcacgactggcgctttctggacgcggcgggggagcagcccaacccggcgttc
gtgctgaatcagcccccgtttcagcagggcagtattctgctggcgcgggaaaactttggc
tgcggatcatcgcgcgagcacgcgccctgggcgctgaccgactacgggtttcgcgtggtt
atcgcccccagctttgccgatatcttttacggcaatgcgtttaacagccagctgctgccc
atcatcctcgacgaggcgcagatagcgacgctgtttgccctggtcggcgcatcgcccggc
atcgcgtttagcgtggacgtggagcagcaaacgctgcaggcgggcgacgcgtgctatacc
tttacgctggacccgttccgccgccattgcctgatccacggtctggacggcatcggcctg
acgctgcggcaggcatcggccatcgccgactacgaagcgcgtcggcccgcgtttctgcgt
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_03000Help
Entry
ETAC_03000        CDS       T02509                                 

Definition
(GenBank) isopropylmalate isomerase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_03000
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_03000
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ETAC_03000
    4.2.1.35  (R)-2-methylmalate dehydratase
     ETAC_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase
Motif
Other DBs
NCBI-ProteinID: AGH72731
Position
complement(695272..696687)
Genome map
AA seq 471 aa AA seqDB search
MGKTLYQKLYDAHIVHQTPGETPLLYIDRHLVHEVTSPQAFDGLRAQGRRVRRPEHTFAT
MDHNVSTQSRDIRACGEMAQIQMETLMANCREFGVQLYDLHHPHQGIVHVIGPEQGMTLP
GTTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQDRARTMQIAIQGRCAAGISA
KDIVLAVIGHLGHAGGTGYVVEFCGPAVQALSMEGRMTLCNMAIELGAKAGLVAPDDTTF
AYLQGRPFAPQGALWQQAVDHWRTLRSDADAQYDRVVTLQADDIAPQVTWGTNPGQVIAI
DTPIPSPASLADPIARASAHKALAYMDLQPGTRMSDVAIDRVFIGSCTNSRIEDLRAAAA
IARGRRVAPGVQAMVVPGSGPVKAQAEAEGLDKIFTEAGFEWRLPGCSMCLAMNNDRLGS
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVCGHFADIRQLQEHDHD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacactgtaccaaaagctgtatgacgcccatatcgtccatcagacgcccggc
gagaccccgctgctgtatatcgatcgccacctggtgcatgaggtcacctcaccgcaggcc
ttcgacgggctgcgcgcccaggggcgtcgggtgcgccggccggagcatacctttgccacc
atggatcataatgtctccacccagagccgcgacatccgcgcctgcggcgagatggcccaa
attcagatggaaaccctgatggctaactgccgtgagttcggcgtccagctgtacgatctg
caccatcctcaccaagggatagtccacgtcatcggcccagagcaaggcatgaccctgccg
ggaaccaccatcgtctgcggcgactcccataccgccacccacggcgccttcggcgcgctg
gccttcggcatcggcacctccgaggtggagcatgtgctggcaacccagaccctgaagcag
gatcgcgcccgtacgatgcagatagccatccaggggagatgcgccgcggggatcagcgcc
aaggacatcgtgctggcggtcatcgggcacctcggccacgccggcggcaccggatatgtg
gtggagttttgcggcccggcggtgcaggccctgtcgatggagggacgcatgacgctgtgc
aatatggctatcgaactgggcgccaaggccggccttgtcgcaccggacgacacgaccttt
gcctaccttcaggggaggccgtttgccccgcagggcgcactgtggcagcaggccgtcgac
cattggcgcaccctgcgctctgatgcggatgcgcagtacgatcgcgtcgtgaccctgcag
gccgatgacattgccccccaggtcacctggggaaccaatcccggccaggtcatcgccatc
gatacgcccattccctcgccggcgtcgctggccgaccccatcgcccgcgcctcggcccac
aaagcgctggcctatatggatctgcagccggggacgcgcatgagcgacgtcgccatcgat
cgggtctttatcggctcctgtaccaactcccgcattgaagatctgcgggccgccgccgcc
atcgcccgcggacgccgggtcgcgccgggcgtgcaggccatggtggtccccggctctggg
cccgtcaaggcgcaggccgaggccgaagggctggacaaaatctttaccgaggccggtttt
gaatggcgcctgccgggctgttccatgtgcctggcgatgaacaatgaccgcctgggcagc
ggtgaacgctgcgcctcaaccagcaaccgcaattttgaagggcgccaggggcgcggcggg
cggactcatctggtcagcccggccatggccgccgccgccgccgtctgcggccactttgcc
gatattcgccagcttcaggagcatgaccatgactga

KEGG   Edwardsiella piscicida C07-087: ETAC_09055Help
Entry
ETAC_09055        CDS       T02509                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_09055
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_09055
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ETAC_09055
    4.2.1.35  (R)-2-methylmalate dehydratase
     ETAC_09055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AGH73932
Position
2060876..2061379
Genome map
AA seq 167 aa AA seqDB search
MDTRLHGNVWTFGNNINTDIISPPQHMALSIAEAAPYCLAAVNPYFAEQVRPGDILVAGN
NLGSGSSRETSPLTLKYLGIQAVVARSFARIFYRNCINLGIPALSAPRASEIRQGDALSI
DIAQGIILNITQQEIYPCTRLPDHIMAMIRAGGLVNYLRQTGGRDAN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggatacgcggctacacggtaatgtctggacgtttggcaacaatatcaacaccgatatc
atctcaccgccgcagcatatggcgctgagcatcgccgaggccgccccttactgcctggcc
gccgtcaacccctacttcgccgaacaggtgcgccccggggatattctggtggccggcaat
aacctgggctccggctcgtcgcgcgaaacctcgccgctcaccctcaagtatctggggatc
caggcggtggtggcccgctccttcgcccgcattttctaccgtaactgcatcaatctgggg
atccccgcgctcagcgcgccgcgcgccagcgagatccgccagggcgatgcgctctccatc
gatatcgcccagggcattatcctcaatatcacccagcaagagatctacccctgtacccgc
ctgccggatcacatcatggcgatgatccgcgccggcggcctcgtgaactatctcagacaa
accggaggtcgtgatgcaaactga

KEGG   Edwardsiella piscicida C07-087: ETAC_09310Help
Entry
ETAC_09310        CDS       T02509                                 

Definition
(GenBank) homoaconitate hydratase family protein
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_09310
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_09310
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ETAC_09310
    4.2.1.35  (R)-2-methylmalate dehydratase
     ETAC_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521 DUF2278
Motif
Other DBs
NCBI-ProteinID: AGH73983
Position
2124054..2125319
Genome map
AA seq 421 aa AA seqDB search
MGKTIAEKIIAEKAGVAEVSAGDVVWVNVDKAMMDDILGPRVQIAEQMEMLKMPILYRDR
VVVISDHYTPPANTRQADIVKFTRDWSRDHGISNYHEFKGPCHQIMVEEGHVLPGTLILG
TDSHTCMGGALGAFASGVGSTEMLGILVTGKTWLKVPETQKVEWNGKLQPGVMAKDISLK
TIGRIGHAGATYHSVEFCGSTFADMPIEQRMAITNMAVEMGAKVGLMPVDRLAQEYLESM
GISAEQYQIYQPDADAHYINTLHFNAEDLPPQIACPHNVDNVTDIINVAGKKIDQAYLGS
CTGGRYSDLEAAANFLKGKKIASGIRFLVSPASQKIWQKASHDGILSTLADAGATILAPT
CGVCVGLHSGLLADDETCISASNRNFIGRMGSKTSNIYLASPLSVAAAALTGYIASPQNF
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaacaattgctgagaaaattatcgcggaaaaggctggcgttgcagaggtcagt
gctggtgatgtcgtttgggttaatgtggataaggcgatgatggatgacatcctcgggcct
cgggtgcagattgcagagcagatggaaatgctcaagatgccaattctgtaccgcgatcgt
gtcgttgttatctcggatcactacacacctccggcgaatacccgacaggctgacattgtc
aaatttaccagggattggtcccgagaccacggcatcagtaattatcatgaatttaaaggg
ccatgccaccagatcatggttgaagaagggcatgttcttccgggtactttgattctggga
acagattcacatacctgcatggggggagcgcttggtgctttcgccagtggcgtcggctct
acggagatgctggggatcttagtcacagggaaaacctggctaaaggtgcctgaaacccag
aaggtcgaatggaatggtaaactccagccgggagtgatggccaaagacatctcattgaaa
acgatcggccgtatcggccatgctggggcgacctatcattcagttgagttctgtggttca
acatttgctgatatgccaattgaacagcgtatggccatcaccaacatggccgtcgaaatg
ggtgctaaagtcggtttgatgccagttgatagactggctcaggaatacttggagagtatg
ggcattagcgccgaacaatatcaaatatatcaacctgatgccgatgcacactatattaac
acgctccactttaatgctgaggatctgcctccgcaaatcgcctgcccgcataatgtggat
aatgtgacagacattatcaatgttgccggaaaaaaaatcgatcaggcttacctcggctca
tgcaccggtggtcgttatagtgacctagaagcggcagccaattttttgaaaggtaaaaaa
atagccagtggtatccgcttcctcgtctccccggcatcacaaaaaatatggcaaaaagcc
agtcatgatgggatcctaagcactcttgctgatgccggcgcgaccattcttgctccaacc
tgtggcgtctgtgtcggcctacattccggtctgttagctgatgatgaaacatgcatttct
gccagtaaccggaactttattggccgtatgggaagcaaaacatcaaatatttacctggca
tcaccgctatctgtagcagcagcagcattaaccggatatatagcttcaccgcaaaacttt
atgtga

KEGG   Edwardsiella piscicida C07-087: ETAC_09315Help
Entry
ETAC_09315        CDS       T02509                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit 1, putative
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_09315
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_09315
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ETAC_09315
    4.2.1.35  (R)-2-methylmalate dehydratase
     ETAC_09315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N PEP-utilizers
Motif
Other DBs
NCBI-ProteinID: AGH73984
Position
2125330..2125833
Genome map
AA seq 167 aa AA seqDB search
MNNHIRGKVWKFGDNINTDIISPPQYMELSIKDAAPYCMSAVNPDFASQVRVGDIFVAEN
NLGSGSSRETSPLTLKYLGIQAVVACSFARIFYRNCINLGIPAITTHQASEIHQGDDLVI
DITQGEIKNITQGTIYQCTKLPDNIMEMIRAGGLVNYLKKVGANHAN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcatattcgaggtaaggtttggaaattcggtgataatataaacacggatatt
atctcccctcctcaatatatggaactaagcattaaagatgctgctccatattgcatgtca
gcggtcaatcctgattttgccagtcaggttagagtgggtgatatttttgtcgcagaaaat
aaccttggctcaggatcttcccgcgagacctctcccttaacattaaaataccttggtatt
caggctgttgtcgcatgttcttttgctcggattttttatcgcaattgcattaaccttggt
attcctgcaataacgacacatcaggcaagcgagattcatcagggggatgatttagttatt
gatattactcagggtgagattaaaaacataacgcagggaacgatttatcagtgcaccaag
ctacctgataatattatggagatgatccgcgccgggggattggtaaactatttaaaaaaa
gtaggagctaatcatgcaaactga

DBGET integrated database retrieval system