KEGG   Edwardsiella piscicida C07-087: ETAC_03005Help
Entry
ETAC_03005        CDS       T02509                                 

Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ETAC_03005
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_03005
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     ETAC_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGH72732
Position
complement(696690..697781)
Genome map
AA seq 363 aa AA seqDB search
MSHSHHIAVLPGDGIGPEIMAQANKVMDAVRSRFGLRITTSEYDIGGIAIDRHGTPLPEA
TLRGCEQADAILFGSVGGPRWEHLPPASQPERGALLPLRKHFKLFSNLRPARLYPGLESL
CPLRADIAARGFDILCVRELTGGIYFGQPKGREGQGMHQRAFDTEVYYRFEIERIARLAF
EAAASRRARVTSIDKANVLQSSLLWREVVNEIAQDYPQVALNHMYIDNATMQLIKDPAQF
DVLLCSNLFGDILSDECAMLTGSMGMLPSASLNEHGFGLYEPAGGSAPDIAGQNLANPIA
QILSLALLLRHSLSAEAAAAAIERAVNQALTQGVKTADLAADAQAVSTDEMGDAIARLIT
QEA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcccatcacattgccgtactgcccggcgacggcatcggcccggaaatcatg
gcgcaggccaataaggtcatggacgccgttcgcagccgctttgggctgcgtatcaccacc
agcgaatacgacatcggcggcatcgccatcgatcgccacggcaccccgctgccggaggcg
accctgcgcggctgcgagcaggccgacgcgattctgttcggctccgtcggcgggccgcgc
tgggagcacctgccgccggccagccaaccggagcggggtgccctgctgccgctgcgtaaa
cactttaagctgttcagcaacctgcggccggcgcgcctctatccggggctggagtccctg
tgcccactgcgcgccgatatcgccgcccgcggcttcgacattctgtgcgttcgcgaactg
accggcggcatctacttcggccagcccaaaggacgcgagggacagggcatgcatcagcgc
gccttcgacaccgaagtctactaccgctttgagatcgagcgcattgcccgcctggccttc
gaggcggcagcctctcgccgcgcgcgggtgacctccatcgacaaggccaacgtattgcaa
agttcgctgctgtggcgcgaggtggtcaacgaaatagcgcaagactacccccaggtggcg
ctgaaccatatgtatatcgacaacgccaccatgcagctgatcaaggatccggcgcagttt
gatgtgctgctgtgcagcaacctcttcggcgatattctctccgacgagtgcgccatgctg
accggctccatggggatgctgccctccgccagcctgaatgaacacggctttggcctgtat
gaaccggcgggcggctccgcgccggacatcgctgggcagaatctggccaacccgatagcc
cagatcctgtcgctggcgctgctgctgcgccacagcctgtccgccgaggcggccgccgcg
gcgattgagcgcgccgtcaaccaggcgctgacccaaggcgttaagaccgcggatttggcc
gccgacgcgcaggcggtctccaccgacgaaatgggtgatgccatcgcccgactgattaca
caggaggcctaa

DBGET integrated database retrieval system