KEGG   Edwardsiella piscicida C07-087: ETAC_03010Help
Entry
ETAC_03010        CDS       T02509                                 

Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_03010
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_03010
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     ETAC_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer ThiD2 Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AGH72733
Position
complement(697797..699377)
Genome map
AA seq 526 aa AA seqDB search
MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGFPISSPGDFASVRA
IAQRVKQSRVCALARCVDADIDAAAEALRAADAFRIHTFLATSTLHLESKLRRSFDDAIA
MARHAILRARRYTDDVEFSCEDAGRTPIDNLCRIVEAAIDAGAKTVNIPDTVGYTTPYQF
GGIIHTLFERVPNIDQAVISVHCHDDLGMACANSISAVQAGARQVEGTLNGIGERAGNCA
LEEVIMAIRTRQDLLQVHTGIRHQEIYRTSQLVSQLCNMPIPANKAVVGANAFAHSSGIH
QDGVLKNRENYEIMTPESIGLPQTQLNLTSRSGRAAVKHRMEEMGYREGNDFDLERLYQA
FLRLADKKGQVFDYDLEALAFIDRQQEEADHFRLEYFSVQSGSSVMATASVRLICGAETR
AEAATGNGPVDAVYQAINRITDISVDIVKYQLSAKGQGRDALGQVDIVAEHQGRRFHGVG
LTTDIVESSAQALIHVLNHIWRARQVEQERQRLHSPAPSISTSSTH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacaggtaattattttcgatacgacgctgcgcgacggggagcaggccctgcag
gccagcctgagcgtgaaggaaaaactgcagatcgccctggcgctggagcgcatgggcgtc
gatgtaatggaggtgggattccctatctcctcccccggcgacttcgcctcggtgcgcgcc
atcgcccaacgggtgaaacagagccgggtgtgtgcactggcccgctgcgtcgatgccgat
atcgacgcagcggccgaggcgctgcgcgcggccgacgccttccgcattcacacctttctg
gccacctctacgctgcatctggagtccaagctgcgccgctcattcgatgacgctatcgcg
atggcccggcacgcgattctgcgcgcccgtcgctataccgacgacgtcgagttctcctgc
gaggacgccgggcgcacccccatcgataatctgtgtcgcatcgtcgaagccgccatcgac
gccggcgccaagaccgtcaacatcccggatacggtgggctataccaccccttatcagttc
ggcggcattatccacaccctgtttgagcgggtacccaatatcgaccaggccgttatctcc
gtacactgccacgatgacctgggcatggcctgcgccaactcaatcagcgccgtccaggct
ggcgcccgtcaggtggagggaaccctgaacggcatcggcgaacgcgccggtaactgtgcg
ctggaggaggtgatcatggcgatccgtacccggcaggatctgctgcaggtgcacaccggc
attcgccaccaggagatctaccgcaccagccagttggtcagccagctgtgcaatatgccg
ataccggccaataaggcggtggtcggcgccaatgcctttgcccactcgtcggggattcac
caggatggcgtgctgaaaaaccgcgaaaactacgaaatcatgacgccggagtccatcggc
ctgccgcagacccagctgaacctgacctcccgctccgggcgcgccgcggtgaaacaccgc
atggaggagatgggctaccgcgagggcaacgactttgatctggagcgtctgtaccaggcc
tttttacgcctggcagataaaaaaggtcaggtgtttgactacgacctggaggcgctggcc
tttatcgatcgccagcaggaagaggcggaccatttccgtctggagtacttcagcgtgcag
tccggcagcagcgtcatggccaccgcctccgtgcggctgatctgcggggctgaaacccgc
gccgaggctgcgaccggcaacggcccggtcgacgcggtctatcaggccatcaaccgcatc
accgacatttcggtcgatatcgtgaagtatcagctgtcggccaaaggccaggggcgcgat
gccctgggtcaggtggatatcgtcgccgagcaccagggccggcgttttcacggcgtcggg
ctgacgaccgatatcgtcgaatcctccgcccaggcgctgatccatgtgctgaaccatatc
tggcgcgcccgtcaggtcgagcaggagcgccagcggctgcactcgcccgccccgtcaatc
tcaacttcgtctacccattaa

DBGET integrated database retrieval system