KEGG   Edwardsiella piscicida C07-087: ETAC_03020Help
Entry
ETAC_03020        CDS       T02509                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00071  Fatty acid degradation
etc01100  Metabolic pathways
etc01212  Fatty acid metabolism
etc02024  Quorum sensing
Module
etc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_03020
   00071 Fatty acid degradation
    ETAC_03020
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_03020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_03020
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_03020
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     ETAC_03020
Lipid biosynthesis proteins [BR:etc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   ETAC_03020
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   ETAC_03020
  Exosomal proteins of breast cancer cells
   ETAC_03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AGH72735
Position
701237..703039
Genome map
AA seq 600 aa AA seqDB search
MIKALDNYHLVARIQGQIANSPNRVALRDWSPTADVAYRWREVGEQVSRLACALLALGVE
VQERVAIFAHNSVAWSLADLAILHLRAVTVPVYATNTAAQAAYILNDASVRILFVDGQAQ
YDAALALRECCPQLTRIIALSDGIDLRGCAIACHLHAFAPGGDSASLARLAQRIDAASLD
DLFTLIYTSGTTGEPKGVMLDYRSLAAQLYLHDARLNVGEQDVSLCFLPLSHVFERAWSF
YVMHSGAQNVYLHDTNLVREAMQAVRPTMMCAVPRFYEKIFSAVQAKVAQAPWLRRQLFR
WAVWCGEQRFLRERAARPQGRLMTAMHRLADRLVLAKLRAILGGRVRFLPAAGAKLDDHV
ILFFQALGLNIKYGYGMTETCATVSCWEEQDFRFGSIGRPLPGVEVRIGEENEIQVRGPI
VMRGYFNKPQETAQTFTADGWLKTGDAGALDAQGHLFITERLKDLMKTSNGKYIAPQLVE
GTLARDRFIEQVAVIADARKFVSALIVPCFDSLEEYARSINLKYHDRLDLLRHSHIVALF
EQRLMEMQKELAKFEQVKRFTLLPQAFSMELGELTPTLKLRRKIILSRYHQEIESMYLDR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagcgttagataattatcatctggtagctcgtattcagggacagattgccaat
tcacccaaccgcgtagcgctgcgcgactggtcgccgacggcggacgtcgcttaccgctgg
cgcgaagtcggggagcaggtctcccggctggcctgcgcgctgctggcgctgggcgtagag
gtacaggagcgggtggccatctttgcccataactcggtggcctggtcgctggccgatctg
gcgatcctgcatctgcgggcggttacggtgccggtctatgcgaccaatacggcggcgcag
gcggcctatattctcaatgatgccagcgttcgtatcctgtttgtcgacggtcaggcccag
tatgacgccgcgttggctctgcgcgagtgctgtccgcagctgacccgtatcattgcgctg
tcggatggcatcgatctgcgcggctgcgcgatcgcctgtcatctgcacgcgttcgcgcct
ggcggcgatagcgccagcctcgcacggctggcgcagcgtatcgacgcggcctctctcgac
gatctgtttacgctcatctacacctctggcaccaccggtgagccgaaaggggtgatgctg
gactaccggagtctggccgctcagctgtatctgcacgatgcccgtctgaacgtcggtgag
caggatgtctctctgtgcttcctgccgctctctcatgtttttgagcgcgcctggagcttt
tatgtgatgcacagcggtgcgcaaaacgtctatctgcacgacacaaacctggtgcgagag
gcgatgcaggcggtgcgtcccaccatgatgtgtgcggttcctcgcttttatgaaaagatt
ttcagcgcggtgcaggccaaggtcgcccaggcaccgtggctgcgtcgtcagctgtttcgc
tgggcggtgtggtgcggcgagcagcgctttttacgcgaacgcgcggcgcgtccccagggg
cgcttgatgacggcgatgcaccgtttggccgatcggctggtgctggcgaagctgcgcgcg
attttaggcggtcgggtgcgctttttaccggcggccggtgccaagctggatgaccatgtg
atcctgtttttccaggcgctgggactgaatatcaagtatggctatggcatgacggaaacc
tgcgcgacggtctcctgctgggaagagcaggacttccgctttgggtctattggccgtccg
ttgcccggggtcgaggtgcgcatcggtgaagagaatgagatccaggtgcgcgggcctatc
gtgatgcgcggctatttcaataagccgcaggagacggcgcagacctttaccgccgacggc
tggctgaagaccggtgacgccggtgcgctggatgcgcagggccacctgtttattaccgag
cggctgaaggatctgatgaagacctccaacggcaagtacattgcccctcagctggtggag
gggacgctggcgcgcgatcgctttatcgagcaggtggcggtgattgccgatgcgcgtaag
tttgtttctgcgctgatcgttccctgcttcgactcgctggaggagtatgcgcgctctatc
aacctcaagtatcacgatcgactggatctgctgcgccatagccatatcgttgcgctgttt
gagcagcgtttgatggagatgcaaaaggagctggccaagtttgagcaggtcaagcgcttt
actctgctgccgcaggcgttttcgatggagctgggcgagctgacgccgacgctgaagctg
cgccgtaagattatcctgagccgctatcatcaggagatcgagtccatgtatctggatcgc
tag

KEGG   Edwardsiella piscicida C07-087: ETAC_06860Help
Entry
ETAC_06860        CDS       T02509                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00071  Fatty acid degradation
etc01100  Metabolic pathways
etc01212  Fatty acid metabolism
etc02024  Quorum sensing
Module
etc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_06860
   00071 Fatty acid degradation
    ETAC_06860
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_06860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_06860
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_06860
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     ETAC_06860
Lipid biosynthesis proteins [BR:etc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   ETAC_06860
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   ETAC_06860
  Exosomal proteins of breast cancer cells
   ETAC_06860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGH73493
Position
1565806..1567485
Genome map
AA seq 559 aa AA seqDB search
MEKVWLKRYPVDVPAEINPDHYASLVDMFEHAVARYADQPAFINMGQVMTFRKLEERSRA
FAAYLQNGLGLQKGDRVALMMPNLLQYPIALFGILRAGMVAVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVFSTQVRHVILTRMGDQLPAAKGTLVNFVVKYIKRLVPKYNL
PDAISFRRALQRGRRMQYVKPDIVNDDLAFLQYTGGTTGVAKGAMLTHRNMQANLEQAKA
AYSPLLKVGHEMVVTALPLYHVFALTVNCLLFIELGGRNLLITNPRDIPGMVRELSRYPF
TALTGVNTLFNALLHNEDFRELDFSSLRLSVGGGMPVQKAVAERWEQLTGHHLLEGYGLT
ECSPLVAGNPYDLKRYSGSIGLPVPSTDVRLVDDEGREVALGEAGELQVRGPQVMRGYWQ
RPEATEEIMRDGWLATGDVCTMDEQGFLRIVDRKKDMILVSGFNVYPNEIEEVVALHPKV
LECAAIGVPSESSGEMVKVCVVKRDPSLTRDELVSHCRRHLTGYKVPKQVVFYTELPKSN
VGKILRRTLREAQAADDKR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaggtttggcttaaacgctatccggtagatgtgccggcggaaatcaatccggat
cattacgcctcgctggtggacatgtttgaacacgccgtagcacgctacgcggatcagcct
gcgttcatcaatatgggacaggtaatgaccttccgcaaactggaggagcgcagccgcgcc
tttgccgcctacctgcaaaacggtcttgggctgcagaagggggatcgcgtcgcgctgatg
atgcccaacctactgcagtatccgatcgcgctgttcggcattctgcgcgccgggatggtg
gcggtcaacgtcaacccgctgtataccccgcgcgagctggagcaccagctgaatgacagc
ggcgccagcgcgattgtcatcgtctcgaactttgcccataccctggaaaaggtggtgttc
tcgactcaggttcgccacgtgatcctgacgcggatgggcgatcagctgccggcggcgaaa
ggcacgctggttaactttgtggtcaagtacatcaagcgcctggtgcctaaatataatctg
ccggacgcgatctcgttccgccgtgcgctgcagcgcgggcgacgcatgcagtatgttaag
ccggatatcgtcaacgatgatttggcctttctgcaatataccggcggtacgaccggcgtc
gccaagggggcgatgctgacccaccgcaatatgcaggcgaacctggagcaggccaaggcg
gcctatagtccgctgctgaaggtgggtcatgaaatggtggtgacggcgctgccgctctac
cacgtctttgcgctgacggtaaactgcctgctgtttattgagctgggcggacgcaatctg
ctgatcactaacccgcgcgatattccgggcatggtccgtgagctgagccgttacccgttc
acggcgttgaccggggtgaatacgctgtttaacgcgctgctgcacaatgaagacttccgc
gagctggacttttcgtcgctgcggctgtcggtgggcggcgggatgccggtgcaaaaggcg
gttgccgaacgctgggagcagctgaccggtcaccatttactggagggctacgggctgacc
gagtgctcaccgctggtggcggggaacccctacgatctgaagcgctacagcggcagcatc
gggctgccggtgccgtcgacggatgtccgcttagtggatgacgaaggccgtgaggtcgcg
ttgggggaggcgggagagctgcaggtgcgcggcccgcaggtgatgcgtggctactggcag
cgaccagaggcaacagaagagatcatgcgcgacggttggctggccaccggcgatgtctgc
accatggatgagcagggctttttacgtatcgtcgatcgcaagaaggatatgatcctggtc
tccggctttaacgtgtatcccaatgagatcgaagaggtggtggcgctgcatcccaaagtg
ttggagtgcgcggccatcggtgttcccagcgaaagctcgggtgagatggtcaaggtgtgc
gtggtcaagcgcgaccctagcctgacccgcgatgagctggtgagccactgccgccgccat
ctgaccggctataaagtaccgaagcaggtggtgttttatacggagctgcccaagagcaac
gtgggtaagattttacgccggacgctgcgcgaagcacaggcggcggatgacaaacggtag

DBGET integrated database retrieval system