KEGG   Edwardsiella piscicida C07-087: ETAC_03195Help
Entry
ETAC_03195        CDS       T02509                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase subunit E1
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03195 (aceE)
   00020 Citrate cycle (TCA cycle)
    ETAC_03195 (aceE)
   00620 Pyruvate metabolism
    ETAC_03195 (aceE)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ETAC_03195 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AGH72770
Position
740771..743434
Genome map
AA seq 887 aa AA seqDB search
MSDRLLNDVDPIETRDWLQAIESVIREEGVERAQYLIDQVLNSARQGGVNLPSAALAHNY
VNTIAPEDEPAYPGNLELERRIRIAMRWNAVMIVLHASKKDLELGGHIASYQSSATVYEV
CFNHFFRARNQKDGGDLVYFQGHISPGIYARAFLEGRLTEEQLNNFRQEVHGTGLSSYPH
PKLMPEFWQFPTVSMGLGPLGAIYQAKFLKYLNHRGLKDTTAQRVYAFLGDGEMDEPESK
GAITIATRDKLDNLCFVINCNLQRLDGPVTGNGKIINELEGIFAGAGWNVIKVIWGSRWD
ALLRKDTSGKLIQLMNETLDGDYQTFKSKNGAYVREHFFGRYPETAALVKDMSDDEIWAL
NRGGHDPKKVYAAFKKAEETKGQPTVILVHTIKGYGMGDTAEGKNIAHQVKKMNMDGVRH
FRDRFNVPVADADLEKLPYVTFDADSEEARYLHERRAALQGYVPTRSPTFSERLELPALE
DFSALLEEQNKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQRYTPQDREQVAYYKEDEKGQILQEGINELGAGASWLAAATSYSTNDLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPQGVEEGIRRGIYKLDTQ
SGDKGKVQLLGSGSMLRHVREAARILSEEYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPASDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIAASVVADAIGKFNIDPEKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcgtttactcaatgacgtggatccgatcgaaacccgcgattggctgcaggcg
atagaatcggtcatccgtgaagaaggcgtagagcgcgcgcagtatctgatcgatcaggta
ctgaattccgcccgtcagggcggcgttaatctgccttccgctgcgctggcccacaattac
gtgaacaccattgctccggaagatgagccggcctatccggggaatctggagctggagcgt
cgtatccgcatcgccatgcgttggaatgcggtgatgatcgtcctgcatgcgtcgaagaaa
gatctggagctgggcggtcacatagcctcctatcagtcttctgcgacggtgtatgaagtg
tgctttaaccatttcttccgcgcccgtaaccagaaggacggcggcgatctggtctacttc
cagggccatatctctccggggatctacgcgcgcgccttcctggaaggacgcctgaccgag
gagcagctgaataacttccgtcaggaggttcacggcacggggctctcttcttacccgcat
ccgaagctgatgccggagttctggcagttcccgaccgtttccatgggtctggggccgttg
ggggcgatttatcaggctaagttcctgaaatacctgaatcaccgaggtctgaaagacacc
acggcgcagcgcgtttacgccttcctcggcgacggtgagatggatgagccggaatccaag
ggcgccatcaccatcgccacccgcgataagctggacaacctgtgcttcgtcattaactgc
aacctgcagcgtctggatggcccggtgacggggaacggcaagatcatcaacgaactggaa
ggcatcttcgccggtgcgggctggaacgtgatcaaggtgatttggggctcccgctgggat
gcgctgctgcgtaaagataccagcggtaagctgatccagctgatgaatgaaaccctggac
ggcgactaccaaaccttcaagtcaaagaatggcgcctatgtgcgtgaacacttctttggc
cgttatccggaaaccgcggcgctggtcaaggatatgtctgacgatgagatctgggcgctg
aaccgcggcggccacgatccgaagaaagtctacgccgcctttaagaaagccgaagagacc
aaaggtcagccgacggtgatcctggtgcataccatcaagggctatggcatgggcgacacc
gccgaaggcaaaaacatcgctcaccaggttaagaagatgaacatggatggcgtgcgccat
ttccgcgatcgcttcaacgtgccggtggccgatgccgatctggagaagctgccgtacgtc
acctttgacgccgactccgaagaggcgcgctatctgcatgagcgtcgcgccgcgctgcag
ggctatgtcccgacccgtagcccgacctttagcgagcgtctagaactgccggcgctggag
gacttctccgccctgctggaagagcagaacaaagagatttcgaccaccatcgccttcgta
cgtgcgttgaacgtaatgctgaagaacaagtccatcaaggatcgtctggtgccgatcatc
gctgacgaagcgcgtaccttcggtatggaagggctgttccgtcagattgggatctatagc
ccgaacggccagcgctacaccccgcaggatcgcgagcaggtggcctactacaaagaagac
gagaaaggacagattctgcaggaggggatcaacgagctgggcgccggggcctcttggctg
gcggcagcgacctcttacagcactaacgatctgccgatgatcccgttctacatctactac
tccatgttcggcttccagcgcatcggcgacctgtgctgggcggcgggcgaccagcaggcg
cgcggtttcctgatcggcggcacctctggacgcaccaccctgaacggggaaggtctgcag
cacgaagatggccacagccatattcagtccctgactatcccgaactgcatctcctacgat
ccggcctatgcctatgaagtggccgtgatcatgcacgacggtctggagcgcatgtacggt
gagaagcaggagaacgtgtactactacatcaccacgctgaacgaaaactaccacatgccg
gcgatgccgcagggcgttgaagagggcatccgccgcgggatctacaagctggatacgcag
tccggcgataagggcaaggtccagttgctgggctccggctccatgctgcgccacgtccgc
gaggccgcgcgtattctgtctgaagagtatggcgttggcagcgatgtgtacagcgtgacc
tccttcaccgagctggcgcgcgatggccaggactgcgagcgttggaacatgctgcatccg
ctggagaccccgcgcgtaccgtacatcgctcaggtgatgaacgatgcgccggccgtggcg
tctaccgactatatgaaactgtttgccgagcaggtacgtacctatgttccggccagcgat
taccgcgtgctgggcaccgatggcttcggccgctccgacagccgtgaaaacctgcgtcac
cactttgaggtcgatgcctcctacgtggtggtggcggcactgggtgaactggcaaaacgc
ggggagatcgccgcttccgtggtggcggacgccatcggcaagttcaatatcgatccggaa
aaagtaaacccgcgtctggcataa

DBGET integrated database retrieval system