KEGG   Edwardsiella piscicida C07-087: ETAC_03195Help
Entry
ETAC_03195        CDS       T02509                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase subunit E1
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03195 (aceE)
   00020 Citrate cycle (TCA cycle)
    ETAC_03195 (aceE)
   00620 Pyruvate metabolism
    ETAC_03195 (aceE)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ETAC_03195 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AGH72770
Position
740771..743434
Genome map
AA seq 887 aa AA seqDB search
MSDRLLNDVDPIETRDWLQAIESVIREEGVERAQYLIDQVLNSARQGGVNLPSAALAHNY
VNTIAPEDEPAYPGNLELERRIRIAMRWNAVMIVLHASKKDLELGGHIASYQSSATVYEV
CFNHFFRARNQKDGGDLVYFQGHISPGIYARAFLEGRLTEEQLNNFRQEVHGTGLSSYPH
PKLMPEFWQFPTVSMGLGPLGAIYQAKFLKYLNHRGLKDTTAQRVYAFLGDGEMDEPESK
GAITIATRDKLDNLCFVINCNLQRLDGPVTGNGKIINELEGIFAGAGWNVIKVIWGSRWD
ALLRKDTSGKLIQLMNETLDGDYQTFKSKNGAYVREHFFGRYPETAALVKDMSDDEIWAL
NRGGHDPKKVYAAFKKAEETKGQPTVILVHTIKGYGMGDTAEGKNIAHQVKKMNMDGVRH
FRDRFNVPVADADLEKLPYVTFDADSEEARYLHERRAALQGYVPTRSPTFSERLELPALE
DFSALLEEQNKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQRYTPQDREQVAYYKEDEKGQILQEGINELGAGASWLAAATSYSTNDLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPQGVEEGIRRGIYKLDTQ
SGDKGKVQLLGSGSMLRHVREAARILSEEYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPASDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIAASVVADAIGKFNIDPEKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcgtttactcaatgacgtggatccgatcgaaacccgcgattggctgcaggcg
atagaatcggtcatccgtgaagaaggcgtagagcgcgcgcagtatctgatcgatcaggta
ctgaattccgcccgtcagggcggcgttaatctgccttccgctgcgctggcccacaattac
gtgaacaccattgctccggaagatgagccggcctatccggggaatctggagctggagcgt
cgtatccgcatcgccatgcgttggaatgcggtgatgatcgtcctgcatgcgtcgaagaaa
gatctggagctgggcggtcacatagcctcctatcagtcttctgcgacggtgtatgaagtg
tgctttaaccatttcttccgcgcccgtaaccagaaggacggcggcgatctggtctacttc
cagggccatatctctccggggatctacgcgcgcgccttcctggaaggacgcctgaccgag
gagcagctgaataacttccgtcaggaggttcacggcacggggctctcttcttacccgcat
ccgaagctgatgccggagttctggcagttcccgaccgtttccatgggtctggggccgttg
ggggcgatttatcaggctaagttcctgaaatacctgaatcaccgaggtctgaaagacacc
acggcgcagcgcgtttacgccttcctcggcgacggtgagatggatgagccggaatccaag
ggcgccatcaccatcgccacccgcgataagctggacaacctgtgcttcgtcattaactgc
aacctgcagcgtctggatggcccggtgacggggaacggcaagatcatcaacgaactggaa
ggcatcttcgccggtgcgggctggaacgtgatcaaggtgatttggggctcccgctgggat
gcgctgctgcgtaaagataccagcggtaagctgatccagctgatgaatgaaaccctggac
ggcgactaccaaaccttcaagtcaaagaatggcgcctatgtgcgtgaacacttctttggc
cgttatccggaaaccgcggcgctggtcaaggatatgtctgacgatgagatctgggcgctg
aaccgcggcggccacgatccgaagaaagtctacgccgcctttaagaaagccgaagagacc
aaaggtcagccgacggtgatcctggtgcataccatcaagggctatggcatgggcgacacc
gccgaaggcaaaaacatcgctcaccaggttaagaagatgaacatggatggcgtgcgccat
ttccgcgatcgcttcaacgtgccggtggccgatgccgatctggagaagctgccgtacgtc
acctttgacgccgactccgaagaggcgcgctatctgcatgagcgtcgcgccgcgctgcag
ggctatgtcccgacccgtagcccgacctttagcgagcgtctagaactgccggcgctggag
gacttctccgccctgctggaagagcagaacaaagagatttcgaccaccatcgccttcgta
cgtgcgttgaacgtaatgctgaagaacaagtccatcaaggatcgtctggtgccgatcatc
gctgacgaagcgcgtaccttcggtatggaagggctgttccgtcagattgggatctatagc
ccgaacggccagcgctacaccccgcaggatcgcgagcaggtggcctactacaaagaagac
gagaaaggacagattctgcaggaggggatcaacgagctgggcgccggggcctcttggctg
gcggcagcgacctcttacagcactaacgatctgccgatgatcccgttctacatctactac
tccatgttcggcttccagcgcatcggcgacctgtgctgggcggcgggcgaccagcaggcg
cgcggtttcctgatcggcggcacctctggacgcaccaccctgaacggggaaggtctgcag
cacgaagatggccacagccatattcagtccctgactatcccgaactgcatctcctacgat
ccggcctatgcctatgaagtggccgtgatcatgcacgacggtctggagcgcatgtacggt
gagaagcaggagaacgtgtactactacatcaccacgctgaacgaaaactaccacatgccg
gcgatgccgcagggcgttgaagagggcatccgccgcgggatctacaagctggatacgcag
tccggcgataagggcaaggtccagttgctgggctccggctccatgctgcgccacgtccgc
gaggccgcgcgtattctgtctgaagagtatggcgttggcagcgatgtgtacagcgtgacc
tccttcaccgagctggcgcgcgatggccaggactgcgagcgttggaacatgctgcatccg
ctggagaccccgcgcgtaccgtacatcgctcaggtgatgaacgatgcgccggccgtggcg
tctaccgactatatgaaactgtttgccgagcaggtacgtacctatgttccggccagcgat
taccgcgtgctgggcaccgatggcttcggccgctccgacagccgtgaaaacctgcgtcac
cactttgaggtcgatgcctcctacgtggtggtggcggcactgggtgaactggcaaaacgc
ggggagatcgccgcttccgtggtggcggacgccatcggcaagttcaatatcgatccggaa
aaagtaaacccgcgtctggcataa

KEGG   Edwardsiella piscicida C07-087: ETAC_03200Help
Entry
ETAC_03200        CDS       T02509                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03200 (aceF)
   00020 Citrate cycle (TCA cycle)
    ETAC_03200 (aceF)
   00620 Pyruvate metabolism
    ETAC_03200 (aceF)
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETAC_03200 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: AGH72771
Position
743448..745316
Genome map
AA seq 622 aa AA seqDB search
MAIAINVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGVISAIKVA
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAQAAAAQVRDVQVPDIGGDEVEVTEILV
KVGDSVSAEQSLITVEGDKASMEVPAPFAGVVQSIAIATGDKVKTGSPIMTFSIAGAASP
APTAAAVAPAAPVAQAAASQPVSVPDIGGDEVEVTEILVKVGDSVSAEQSLITVEGDKAS
MEVPAPFAGVVSAIAVSVGDKVKTGSPIMTFSVAGSAPAPSASAPATAAPVSAPATSAAA
APAAVQTTSEFTENAAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQTYVKELI
KRAETAPAAATGGSLPGLLPWPKVDFSKFGEVEEVELGRIQKISGANLHRNWVMIPHVTQ
FDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAAAKALEAMPRFNSSLSEDAQRL
TLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAEISAKARAGKLTAADMQGGCF
TISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLALSYDHRVIDG
ADGARFISFINSVMSDIRRLVM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaatgtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtctctgattaccgttgaaggcgac
aaggcttcaatggaggtcccctcgccgcaggccggcgttatcagcgctatcaaggttgcg
gtgggcgataaggtcacgaccggctctctgatcatggagttcgaggcggccgatgccgct
gcggcccagccggcggcccaagtgcaaccggcagcggctcaggctgccgctgcacaggtg
cgtgacgttcaggtgccggatatcggtggcgatgaagtggaagtcaccgagatcctggtg
aaggtcggcgacagcgttagcgctgaacagtcgctgatcaccgtcgaaggcgataaagcc
tcgatggaggtgccggcgccgttcgccggggtggttcaatccatcgctatcgccaccgga
gacaaggtgaagaccggttcgccgatcatgacctttagcatcgcgggcgccgcctctccg
gccccgacagcggcggccgtcgcgcctgccgcgccggtggcccaggctgccgccagccag
ccggtcagcgtgccggatatcggcggtgatgaggttgaagtcaccgaaattctggtcaag
gtgggcgacagcgtcagcgctgaacagtcgctgatcaccgtcgaaggcgataaggcttcg
atggaggtgccggcgccgtttgccggggttgtcagcgccatcgcagtcagcgtgggcgat
aaggtgaaaaccggctcgccgatcatgaccttcagcgtggcgggcagcgcgcctgcgccg
tcggcatctgcgccagcgaccgcggcgccggtaagtgcgccagccacctccgcggctgca
gcgcctgcggcggtacagacgacgagcgagttcaccgaaaacgccgcctatgtgcatgcg
acgccggtgatccgccgtctggcgcgtgagtttggcgttaacctggccaaggtaaaaggt
agcgggcgtaagggccgcattctgcgcgaagacgtacagacctatgtcaaagagctgatt
aagcgcgcagaaaccgcgccagcggcggcaaccgggggctctctgccgggtctgctgccg
tggccgaaggtggacttcagcaagttcggcgaggtggaagaggttgagctggggcgtatc
cagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtcacccag
tttgatgagaccgatatcaccgaggtggaagcgttccgcaaacagcagaacgtggagtcc
gagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcggcggcc
aaggcgttagaggcgatgccgcgctttaacagctccctgtctgaggatgcccagcgtctg
acgctgaagaagtacatcaacatcggcgtcgcggtcgatacgccgaacggcctggtggtt
ccggtgctgcgcgacgtcaacaagaagggcatcatcgagctgtcgcgcgatctggcggag
atctcagccaaggcgcgcgccggcaagctgaccgccgcggacatgcagggcggctgcttc
actatctccagcctgggcggtatcggcggcacggcgtttacgccgatcgtcaacgcaccg
gaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatgggaaagag
tttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggtgatcgacggt
gccgacggcgcccgctttatcagcttcatcaacagcgtgatgtccgacatccgccgcctg
gtgatgtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_03205Help
Entry
ETAC_03205        CDS       T02509                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00260  Glycine, serine and threonine metabolism
etc00280  Valine, leucine and isoleucine degradation
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03205
   00020 Citrate cycle (TCA cycle)
    ETAC_03205
   00620 Pyruvate metabolism
    ETAC_03205
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_03205
   00640 Propanoate metabolism
    ETAC_03205
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_03205
   00280 Valine, leucine and isoleucine degradation
    ETAC_03205
   00310 Lysine degradation
    ETAC_03205
   00380 Tryptophan metabolism
    ETAC_03205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_03205
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ETAC_03205
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ETAC_03205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like Thi4 NAD_binding_8 FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: AGH72772
Position
745582..747012
Genome map
AA seq 476 aa AA seqDB search
MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVIGQLTGGLAGMAKGRKVRVVNGLGKFT
SANTLTVDGEAGQTVIHFDNAIIAAGSRPIQLPFIPHDDPRVWDSTDALALNSVPQRLLV
MGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRIGKRFNLMLETKVTA
VEAREDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKLIDAGLAGVEVDERGFIHVDKQ
LRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWV
GLTEKEAREKGISYETATFPWAASGRAIASDCADGMTKLIFDKESHRIIGGAIVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVYEGSITDLPNPKAKKASR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaaatcaaaactcaggtcgtggtacttggggcgggcccggcagggtattct
gcggcgttccgctgcgcggatttagggctggaaaccgtgattgtcgagcgttactccacc
ctgggcggggtgtgcctgaacgtcggctgtatcccctccaaggccctgctgcacgtggct
aaagtgattgaagaggccaaggcgctggcggagcacggtatcgtgttcggcgagccgaag
accgacattgacaagatccgcacctggaaagagaaggtgatcggtcagctgaccggcggc
ctggccggtatggctaaaggccgtaaggtgcgggtggtcaacgggctgggtaagtttacc
tcggccaacaccctgactgttgacggggaagccgggcagacggtgatccactttgataat
gcgatcatcgccgccggttctcgtcccatccaactgccgtttatcccccatgacgatccg
cgcgtatgggattcgaccgacgcgctggccctgaacagcgtgccgcagcgcctactggtg
atgggcggcgggattatcggcctggagatggggacggtatatcatgcgctgggttccgag
atcgacgtggttgaaatgttcgatcaggtgatcccggccgccgataaggacgtggtaaaa
gtctttaccaagcgtatcggcaaacgctttaacctgatgctggagaccaaggtcaccgcc
gtggaggcccgtgaagacgggatctatgtttccatggaaggcaagaaggctccggcagag
gcacagcgttatgacgctgtgctggtggctatcggccgcgtgccgaacggtaagctgatc
gacgccggtctggccggggttgaggtggatgagcgcggctttattcacgtggataagcag
ctgcgtaccaatgtgccgcacatcttcgccatcggcgatatcgtcggtcagccgatgctg
gcgcacaaaggggttcacgaggggcacgttgccgccgaggtgatcgccgggatgaagcac
tacttcgatccgaaggtgatcccttctatcgcctataccgagccagaggttgcatgggtc
ggtctgacggaaaaagaggcgcgcgagaaagggatcagctacgaaaccgccaccttcccg
tgggcggcctcggggcgcgccatcgcctctgactgtgccgacggcatgaccaagcttatc
ttcgacaaagagtcccatcgcatcatcggcggggcgattgtcggcaccaacggcggcgag
ctgctcggtgaaatcggtctggcgatcgagatgggctgcgatgcggaggatattgccctg
acgattcatgcccacccgaccctgcatgagtcggttggcctggcggcggaagtctacgaa
ggtagcatcaccgacctgccgaatccgaaggcgaagaaagcgtcgcgttga

KEGG   Edwardsiella piscicida C07-087: ETAC_16715Help
Entry
ETAC_16715        CDS       T02509                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00260  Glycine, serine and threonine metabolism
etc00280  Valine, leucine and isoleucine degradation
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16715
   00020 Citrate cycle (TCA cycle)
    ETAC_16715
   00620 Pyruvate metabolism
    ETAC_16715
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_16715
   00640 Propanoate metabolism
    ETAC_16715
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_16715
   00280 Valine, leucine and isoleucine degradation
    ETAC_16715
   00310 Lysine degradation
    ETAC_16715
   00380 Tryptophan metabolism
    ETAC_16715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16715
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ETAC_16715
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ETAC_16715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox GIDA K_oxygenase FAD_binding_2 DAO HI0933_like AlaDh_PNT_C FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGH75464
Position
3767205..3768653
Genome map
AA seq 482 aa AA seqDB search
MKELHVDVAVIGGGTAGLGAYRAAKRHTPSVVMIEGGPFGTTCARVGCMPSKLLIAAAES
VHQIARAPAFGIHPQGEVRIDGREVMDRVKRERDRFVGFVMEGVDSIPADDKILGYARFL
DNHTLQVAEHTRIHAKRIVIASGSRPVWPAAWDALGDRLIVNDDLFAWDTLPRAVAVFGP
GVIGLELGQALHRLGVEVKVFGVGGAVGPLTDAEVRRYAADKLGAEFYLDPDAQVEILQR
EGEQVFIRYRDLDGQTQDILVDYVLAATGRRPNVDRLGLENTTLQRDARGVPLADRLTMQ
TNVEHIFIAGDASNQLPLLHEASDQARIAGENAGRYPHIAPGLRRSPLSVVFSDPQIAMV
GSTFRELNEKYGACGCFAVGEVSFENQGRSRVMLRNLGLLHVYAEQGSGRFLGAEMIGPD
AEHLAHLLSWAHQQQMTVDQMLDMPFYHPVIEEGVRTALRDLQSKLRLGSDEIERCLRCP
GD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattacacgtcgacgttgccgtgatcggtggcggcaccgccggtctgggcgcc
tatcgcgcggccaaacgccatacccccagcgtagtgatgattgaaggcggtccctttggc
accacctgcgcccgcgtgggctgcatgccctctaagctgctgatcgccgcggccgaatcc
gtgcatcagatcgcccgcgcacccgccttcggtatccacccccagggtgaggtccgcatt
gacggtcgagaggtgatggaccgcgtgaagcgcgaacgcgatcgcttcgtcggcttcgtc
atggagggcgtcgacagcattcccgcggatgacaaaatccttggctatgcccgctttctg
gacaatcacaccctgcaggttgctgaacatacccgtatccatgccaaacgcatcgtcatc
gccagcggctcacgcccggtatggcctgccgcttgggatgctctgggcgatcgcctgatc
gtcaacgacgatctgttcgcctgggatacgctgccgcgcgccgttgccgtcttcggcccc
ggcgtcatcggccttgagctggggcaagccctgcaccggctcggtgtcgaggtcaaggtc
ttcggcgtcggcggcgccgtcgggccgctgacggatgccgaggtccgccgctatgccgcg
gataaactgggcgcagagttttatctcgaccccgacgcacaggtagagatcctacagcgt
gagggggagcaggtcttcattcgctatcgcgatctggatggtcaaacgcaggatatcctg
gtggactacgttctggccgccaccggccgtcgtcccaacgtcgaccgcctggggctggaa
aacaccaccctacagcgagatgcccgcggcgtaccgctggcggatcgcctgacgatgcag
accaacgtcgagcatatctttattgccggcgacgccagcaaccagctgccgctgctgcac
gaggccagcgatcaggcgcgcattgccggtgagaacgccggtcgctatccccacatagcc
ccgggactgcgccgcagccccctctcggtggtcttttccgacccacagatcgcgatggtg
ggatccaccttccgcgagctgaatgagaaatatggcgcctgcggctgcttcgccgtcggg
gaggtctcatttgaaaaccagggacgatcccgcgtcatgctgcgcaacctgggcctgctg
catgtctatgctgagcagggaagcggccgcttcctcggcgcagagatgatcgggccggac
gccgagcaccttgcccacctgctctcttgggcccatcaacagcagatgaccgtagaccag
atgctggatatgccgttttaccatccggtcatcgaggaaggggtgcgtaccgccctacgc
gatctgcaaagcaaactgcgtttgggcagcgacgaaatcgagcgctgcctgcgctgtccg
ggggattaa

DBGET integrated database retrieval system