KEGG   Edwardsiella piscicida C07-087: ETAC_03200Help
Entry
ETAC_03200        CDS       T02509                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03200 (aceF)
   00020 Citrate cycle (TCA cycle)
    ETAC_03200 (aceF)
   00620 Pyruvate metabolism
    ETAC_03200 (aceF)
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETAC_03200 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: AGH72771
Position
743448..745316
Genome map
AA seq 622 aa AA seqDB search
MAIAINVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGVISAIKVA
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAQAAAAQVRDVQVPDIGGDEVEVTEILV
KVGDSVSAEQSLITVEGDKASMEVPAPFAGVVQSIAIATGDKVKTGSPIMTFSIAGAASP
APTAAAVAPAAPVAQAAASQPVSVPDIGGDEVEVTEILVKVGDSVSAEQSLITVEGDKAS
MEVPAPFAGVVSAIAVSVGDKVKTGSPIMTFSVAGSAPAPSASAPATAAPVSAPATSAAA
APAAVQTTSEFTENAAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQTYVKELI
KRAETAPAAATGGSLPGLLPWPKVDFSKFGEVEEVELGRIQKISGANLHRNWVMIPHVTQ
FDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAAAKALEAMPRFNSSLSEDAQRL
TLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAEISAKARAGKLTAADMQGGCF
TISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLALSYDHRVIDG
ADGARFISFINSVMSDIRRLVM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaatgtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtctctgattaccgttgaaggcgac
aaggcttcaatggaggtcccctcgccgcaggccggcgttatcagcgctatcaaggttgcg
gtgggcgataaggtcacgaccggctctctgatcatggagttcgaggcggccgatgccgct
gcggcccagccggcggcccaagtgcaaccggcagcggctcaggctgccgctgcacaggtg
cgtgacgttcaggtgccggatatcggtggcgatgaagtggaagtcaccgagatcctggtg
aaggtcggcgacagcgttagcgctgaacagtcgctgatcaccgtcgaaggcgataaagcc
tcgatggaggtgccggcgccgttcgccggggtggttcaatccatcgctatcgccaccgga
gacaaggtgaagaccggttcgccgatcatgacctttagcatcgcgggcgccgcctctccg
gccccgacagcggcggccgtcgcgcctgccgcgccggtggcccaggctgccgccagccag
ccggtcagcgtgccggatatcggcggtgatgaggttgaagtcaccgaaattctggtcaag
gtgggcgacagcgtcagcgctgaacagtcgctgatcaccgtcgaaggcgataaggcttcg
atggaggtgccggcgccgtttgccggggttgtcagcgccatcgcagtcagcgtgggcgat
aaggtgaaaaccggctcgccgatcatgaccttcagcgtggcgggcagcgcgcctgcgccg
tcggcatctgcgccagcgaccgcggcgccggtaagtgcgccagccacctccgcggctgca
gcgcctgcggcggtacagacgacgagcgagttcaccgaaaacgccgcctatgtgcatgcg
acgccggtgatccgccgtctggcgcgtgagtttggcgttaacctggccaaggtaaaaggt
agcgggcgtaagggccgcattctgcgcgaagacgtacagacctatgtcaaagagctgatt
aagcgcgcagaaaccgcgccagcggcggcaaccgggggctctctgccgggtctgctgccg
tggccgaaggtggacttcagcaagttcggcgaggtggaagaggttgagctggggcgtatc
cagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtcacccag
tttgatgagaccgatatcaccgaggtggaagcgttccgcaaacagcagaacgtggagtcc
gagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcggcggcc
aaggcgttagaggcgatgccgcgctttaacagctccctgtctgaggatgcccagcgtctg
acgctgaagaagtacatcaacatcggcgtcgcggtcgatacgccgaacggcctggtggtt
ccggtgctgcgcgacgtcaacaagaagggcatcatcgagctgtcgcgcgatctggcggag
atctcagccaaggcgcgcgccggcaagctgaccgccgcggacatgcagggcggctgcttc
actatctccagcctgggcggtatcggcggcacggcgtttacgccgatcgtcaacgcaccg
gaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatgggaaagag
tttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggtgatcgacggt
gccgacggcgcccgctttatcagcttcatcaacagcgtgatgtccgacatccgccgcctg
gtgatgtaa

DBGET integrated database retrieval system