KEGG   Edwardsiella piscicida C07-087: ETAC_03205Help
Entry
ETAC_03205        CDS       T02509                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00260  Glycine, serine and threonine metabolism
etc00280  Valine, leucine and isoleucine degradation
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_03205
   00020 Citrate cycle (TCA cycle)
    ETAC_03205
   00620 Pyruvate metabolism
    ETAC_03205
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_03205
   00640 Propanoate metabolism
    ETAC_03205
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_03205
   00280 Valine, leucine and isoleucine degradation
    ETAC_03205
   00310 Lysine degradation
    ETAC_03205
   00380 Tryptophan metabolism
    ETAC_03205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_03205
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ETAC_03205
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ETAC_03205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like Thi4 NAD_binding_8 FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: AGH72772
Position
745582..747012
Genome map
AA seq 476 aa AA seqDB search
MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVIGQLTGGLAGMAKGRKVRVVNGLGKFT
SANTLTVDGEAGQTVIHFDNAIIAAGSRPIQLPFIPHDDPRVWDSTDALALNSVPQRLLV
MGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRIGKRFNLMLETKVTA
VEAREDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKLIDAGLAGVEVDERGFIHVDKQ
LRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWV
GLTEKEAREKGISYETATFPWAASGRAIASDCADGMTKLIFDKESHRIIGGAIVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVYEGSITDLPNPKAKKASR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaaatcaaaactcaggtcgtggtacttggggcgggcccggcagggtattct
gcggcgttccgctgcgcggatttagggctggaaaccgtgattgtcgagcgttactccacc
ctgggcggggtgtgcctgaacgtcggctgtatcccctccaaggccctgctgcacgtggct
aaagtgattgaagaggccaaggcgctggcggagcacggtatcgtgttcggcgagccgaag
accgacattgacaagatccgcacctggaaagagaaggtgatcggtcagctgaccggcggc
ctggccggtatggctaaaggccgtaaggtgcgggtggtcaacgggctgggtaagtttacc
tcggccaacaccctgactgttgacggggaagccgggcagacggtgatccactttgataat
gcgatcatcgccgccggttctcgtcccatccaactgccgtttatcccccatgacgatccg
cgcgtatgggattcgaccgacgcgctggccctgaacagcgtgccgcagcgcctactggtg
atgggcggcgggattatcggcctggagatggggacggtatatcatgcgctgggttccgag
atcgacgtggttgaaatgttcgatcaggtgatcccggccgccgataaggacgtggtaaaa
gtctttaccaagcgtatcggcaaacgctttaacctgatgctggagaccaaggtcaccgcc
gtggaggcccgtgaagacgggatctatgtttccatggaaggcaagaaggctccggcagag
gcacagcgttatgacgctgtgctggtggctatcggccgcgtgccgaacggtaagctgatc
gacgccggtctggccggggttgaggtggatgagcgcggctttattcacgtggataagcag
ctgcgtaccaatgtgccgcacatcttcgccatcggcgatatcgtcggtcagccgatgctg
gcgcacaaaggggttcacgaggggcacgttgccgccgaggtgatcgccgggatgaagcac
tacttcgatccgaaggtgatcccttctatcgcctataccgagccagaggttgcatgggtc
ggtctgacggaaaaagaggcgcgcgagaaagggatcagctacgaaaccgccaccttcccg
tgggcggcctcggggcgcgccatcgcctctgactgtgccgacggcatgaccaagcttatc
ttcgacaaagagtcccatcgcatcatcggcggggcgattgtcggcaccaacggcggcgag
ctgctcggtgaaatcggtctggcgatcgagatgggctgcgatgcggaggatattgccctg
acgattcatgcccacccgaccctgcatgagtcggttggcctggcggcggaagtctacgaa
ggtagcatcaccgacctgccgaatccgaaggcgaagaaagcgtcgcgttga

KEGG   Edwardsiella piscicida C07-087: ETAC_14150Help
Entry
ETAC_14150        CDS       T02509                                 

Definition
(GenBank) glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_14150
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_14150
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     ETAC_14150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGH74951
Position
complement(3192419..3195301)
Genome map
AA seq 960 aa AA seqDB search
MTQTLTQLENSDAFIARHIGPTPEDQQQMLAQIGAPDLDTLLARIVPADIQLPAAPPIGA
ACSEQQALDELRAIAAQNQCYRSFIGMGYYGVQTPPAIQRNMLENPGWYTAYTPYQPEVS
QGRLEALLNFQQMTLDLTGLDLASASLLDEATAAAEAMALARRASRLKQANVFFIAQDVH
PQTIDVVCTRAESCGIEVIIDDARRAADHRDLFGVLLQLVGTQGDLHDYRALMDALRERG
VITCMAADPLALVLLEAPGRQGADVVFGSAQRFGVPMGYGGPHAAFFACRDAFKRAMPGR
IIGVARDAAGEPALRMAMQTREQHIRREKANSNICTSQVLLANIAGMYAVYHGPQGLRRI
AERVHRLADILALGLQQKGMTLRNHRWFDTLTVAVPDKAAVLARALGFGINLRGDLDGAV
GISFDECSTRDDLEALFTILLGDGHALDIDTLDTLAQEASEGSIPTALLRREPILTHPVF
NRYHSETALMRYMHGLERRDLALNQAMIPLGSCTMKLNAAAEMIPITWPEFAALHPFCPP
EQAQGYRLLLSQLAEWLVQLTGYDAVCLQPNSGAQGEYAGLLAIRRYHESRGEGQRTRCL
IPASAHGTNPASAQMAGMEVEVVACDEQGNIDLHDLRERAQQAGERLAAIMVTYPSTHGV
YEETIREVCQIVHQYGGQVYLDGANMNAQVGITTPGYIGADVSHLNLHKTFAIPHGGGGP
GMGPIGVKAHLAPFVPGHRVVQLPGLTPRQGAVSAAPFGSASILPISWMYIRMMGAEGLR
GASAVAILNANYIARRLGAVYPVLYRGKGGYVAHECILDLRPLKARSGISEMDIAKRLID
YGFHAPTMSFPVAGTLMVEPTESENKAELDRFIAAMLAIHDEIARVEAGEWPLQDNPLVN
APHTQRELVGEWHHPYGRELAVFPTPQTRENKYWPAVKRLDDVYGDRHLQCSCPPLSDWA
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgactcagacccttacccagcttgaaaacagtgacgcttttattgcccgccatatcggc
cccacgccggaggatcagcagcagatgctggcgcagattggcgcaccggatctcgatacg
ctgctggcgcgcatcgtcccggcggatattcagctgcccgccgcgccgcccatcggcgcc
gcctgcagcgagcagcaggcgctggacgaactgcgggcgatcgccgcgcaaaaccaatgc
tacagatcgtttatcggcatgggctattacggcgtgcagacgccgccggccatccagcgc
aacatgctggagaaccccggctggtataccgcctataccccctatcagccggaggtatcc
caggggcgtctggaggcgctgcttaactttcagcagatgacgctggatctgaccgggctg
gatctggcctcggcgtcgctgcttgacgaggcgaccgccgccgccgaggcgatggcgctg
gcgcggcgcgccagccgcctgaagcaggccaatgtgttctttatcgcgcaggatgtgcac
ccccagactatcgacgtggtctgcacccgggccgagagctgcgggatcgaggtgatcatc
gatgacgcccggcgggcggcggatcaccgcgatctgttcggggtgctgctgcagctggtc
ggcacgcagggcgatctgcatgactatcgtgcgctgatggatgccctgcgcgagcgcggg
gtgatcacctgcatggcggccgatccgctggcgctggtgctgctggaggcgccggggcgc
caaggggccgacgtggtgtttggctccgctcagcgctttggcgtgccgatgggctacgga
ggccctcacgccgccttctttgcctgtcgcgatgcgtttaagcgcgccatgccggggcgg
attatcggcgtcgcgcgcgatgccgccggggagccggccctgcgcatggcgatgcagacg
cgtgaacagcatatccggcgagaaaaggccaactccaatatctgtacttcgcaggtgctg
ctggccaatattgccggtatgtatgcggtgtatcacggtccgcaggggctgcgtcgcatt
gccgaacgggttcaccgcctggcggatattctggcgctcggcctacagcagaaggggatg
acgctgcgcaaccaccgctggttcgataccctgacggtggcggtgcccgataaggcggcg
gtgctggcgcgggccctcggctttggcatcaacctgcgcggcgatctggatggtgcggtc
ggcatcagctttgacgagtgcagcacgcgtgacgatctggaggcgctgtttaccatcctg
ctcggtgacggccacgcgctggatatcgataccctggatacgctggcccaggaggccagc
gagggcagtattccgacggcgctgctgcgccgcgagccgatcttgacgcatccggtgttc
aaccgttaccacagcgaaaccgcgctgatgcgctatatgcacgggctggagcggcgcgat
ctggcgctgaatcaggcgatgatcccgctgggctcctgtaccatgaagctgaacgccgcc
gccgagatgatcccgatcacctggcccgaattcgccgcgctgcacccgttctgtccgccg
gagcaggcgcagggctaccggcttctgctgagccagctggcggagtggctggtgcagctg
acggggtatgacgccgtctgcctgcagcccaactcgggcgcgcagggggagtatgccggt
ctgctggcgatccgccgctatcatgaaagccggggcgaggggcagcgcacccgctgcctg
atcccggcctcggcccacggcactaatccggcctcggcgcagatggccgggatggaggtc
gaggtggtggcatgtgatgagcagggcaatatcgatctgcacgatctgcgtgaacgtgcg
cagcaggcgggggagcgcctggcggcgatcatggtgacctacccctcgacccacggcgta
tatgaagagaccatccgcgaggtgtgccagatagtgcatcagtacggtgggcaggtgtat
ctggacggcgccaatatgaacgcgcaggtcgggatcaccacgcccggctatatcggcgcc
gatgtctcgcacctgaacctgcataaaaccttcgccatcccacacggcggcggcgggccg
ggaatggggccgatcggcgttaaggctcacctggcgccctttgttcccggccaccgggtg
gtgcagctgcccggcctgaccccccgtcagggtgcggtcagcgccgcgccgtttggcagc
gcatccattctgcccatcagctggatgtatattcgcatgatgggggccgaggggctgcgc
ggcgccagcgcggtggcgatcctgaacgccaactatatcgctcgccgtctgggggcggtt
tacccggtgctgtaccgcgggaagggggggtatgtggcccacgagtgcatcctggatctg
cgcccgctgaaggcgcgcagcggcatcagtgaaatggatatcgccaagcgtctgatcgac
tatggcttccacgcgccgaccatgtccttcccggtcgccggtacgctgatggttgagccg
acggagtcggagaataaggccgagctggatcgctttatcgccgccatgctggcgattcac
gatgagatcgcgcgcgtcgaggccggtgagtggccgctgcaggataatccgttggtcaat
gcgccccatactcagcgtgagctggtgggcgagtggcatcacccctatgggcgtgagctg
gcggtgtttcctacgccgcagacgcgggagaacaagtattggccggcggtgaagcgcctg
gacgatgtctatggcgatcgtcatctgcagtgctcttgcccgccgctgagcgactgggca
tag

KEGG   Edwardsiella piscicida C07-087: ETAC_14155Help
Entry
ETAC_14155        CDS       T02509                                 

Definition
(GenBank) Glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_14155
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_14155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGH74952
Position
complement(3195391..3195777)
Genome map
AA seq 128 aa AA seqDB search
MSNVPTELKYTASHEWVRAEANGVFCVGITDHAQSLLGDMVFVDLPEVGAHIDTGAECAV
AESVKAASDIYSPLAGEVVAVNGSLEEAPEQVNAAPYDEGWLFRIRADDPAEFAALLSAE
GYLAALDE
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtgccgacagagttgaagtataccgcgtcccatgagtgggtacgcgcagag
gcaaacggggtcttttgcgtcgggatcaccgaccatgcccagagtctgctgggcgacatg
gtgtttgtggatctgccggaggtgggggcgcatatcgataccggcgcggagtgcgcggtg
gccgagtcggtcaaggcggcgtcggatatctatagcccgctggcgggggaggtcgtggcc
gtaaatggctcactggaggaggcgccggagcaggtcaacgcggcgccctatgatgagggc
tggctgttccgtattcgggccgacgatcccgccgagtttgcggcgctgctcagcgccgaa
gggtatctggccgcgctggacgaataa

KEGG   Edwardsiella piscicida C07-087: ETAC_14160Help
Entry
ETAC_14160        CDS       T02509                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_14160
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_14160
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_14160
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     ETAC_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AGH74953
Position
complement(3195816..3196940)
Genome map
AA seq 374 aa AA seqDB search
MAKQTVLYDQHVADGARMVDFHGWMMPLHYGSQLEEHHAVRSDAGMFDVSHMTIVDLHGV
KARDFLRYLLANDVARLTQPGKALYSAMLNASGGVIDDLIVYFLADQHFRLVVNSATRER
DLAWIGEHAPAFGVELRERRDLALIAVQGPTARQRVDALLTPAQRQTVAGMKPFFGRQAG
SLFIATTGYTGEDGYEIALPQDEAVAFWQRLAQAGIRPCGLAARDTLRLEAGMNLYGQEM
DEGISPLAANMGWTIAWAPPERDFIGRAALERQQSQHPEQLVGLVMREKGVLRAGMTIRF
CDEQGNARQGTITSGSFSPTLGCSIALARVPQGIGGEAWVEIRGRELALSVVKPGFVRHG
HSLIPSVDTAAVGN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagacggtgctttatgatcagcatgtggccgacggggcgcgcatggtggat
tttcatggctggatgatgccgctgcactatggctcccagctggaggagcatcatgcggtg
cgcagcgatgccgggatgttcgatgtttcccatatgaccatcgtggatctgcacggggtt
aaggcgcgggactttctgcgctatctgttggccaacgatgtggcgcgcctgacgcagccg
ggcaaggcgctgtacagcgcgatgctgaacgccagcggcggggtgatcgacgatctgatc
gtctactttctggcggatcagcattttcgcctggtggtcaactcggcgacccgcgagcgg
gatttagcctggatcggcgagcatgcgcccgcctttggcgttgagctgcgcgaacgtcgc
gatctggcgctgatcgcggtacaggggccaacggcccgtcagcgggtagatgcgctgctg
acgccggcgcagcgtcagacggtcgccgggatgaaacccttcttcggccgtcaggcggga
tcgctgtttatcgctaccaccggctacaccggggaggatggctacgagatagccctgccg
caggatgaggcggtggccttctggcagcgcctggcgcaggcgggcatcaggccctgcggg
ttggccgcccgcgacacgctgcgtctggaggctggaatgaacctgtatggtcaggagatg
gatgaagggatctcgccgctggcggccaacatgggctggaccatcgcctgggcgccgccg
gagcgtgactttattggccgggcggcgctggagcgtcagcagagccagcatcctgagcag
ctggtcgggctggtgatgcgagagaaaggggtgctgcgggcaggcatgacgatccgcttt
tgcgatgagcagggtaacgcccgtcaggggacgatcaccagcggctcgttttcgccgacg
ctggggtgcagcatcgcgctggcgcgggtgccgcaggggatcggcggcgaggcctgggtc
gagatccgcggtcgcgagctggcgctcagcgtggtgaaaccgggctttgtccgtcacggc
cacagcctgatcccgtccgtcgatacggcggcggtaggcaactaa

KEGG   Edwardsiella piscicida C07-087: ETAC_16715Help
Entry
ETAC_16715        CDS       T02509                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00260  Glycine, serine and threonine metabolism
etc00280  Valine, leucine and isoleucine degradation
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16715
   00020 Citrate cycle (TCA cycle)
    ETAC_16715
   00620 Pyruvate metabolism
    ETAC_16715
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_16715
   00640 Propanoate metabolism
    ETAC_16715
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_16715
   00280 Valine, leucine and isoleucine degradation
    ETAC_16715
   00310 Lysine degradation
    ETAC_16715
   00380 Tryptophan metabolism
    ETAC_16715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16715
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ETAC_16715
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ETAC_16715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox GIDA K_oxygenase FAD_binding_2 DAO HI0933_like AlaDh_PNT_C FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGH75464
Position
3767205..3768653
Genome map
AA seq 482 aa AA seqDB search
MKELHVDVAVIGGGTAGLGAYRAAKRHTPSVVMIEGGPFGTTCARVGCMPSKLLIAAAES
VHQIARAPAFGIHPQGEVRIDGREVMDRVKRERDRFVGFVMEGVDSIPADDKILGYARFL
DNHTLQVAEHTRIHAKRIVIASGSRPVWPAAWDALGDRLIVNDDLFAWDTLPRAVAVFGP
GVIGLELGQALHRLGVEVKVFGVGGAVGPLTDAEVRRYAADKLGAEFYLDPDAQVEILQR
EGEQVFIRYRDLDGQTQDILVDYVLAATGRRPNVDRLGLENTTLQRDARGVPLADRLTMQ
TNVEHIFIAGDASNQLPLLHEASDQARIAGENAGRYPHIAPGLRRSPLSVVFSDPQIAMV
GSTFRELNEKYGACGCFAVGEVSFENQGRSRVMLRNLGLLHVYAEQGSGRFLGAEMIGPD
AEHLAHLLSWAHQQQMTVDQMLDMPFYHPVIEEGVRTALRDLQSKLRLGSDEIERCLRCP
GD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattacacgtcgacgttgccgtgatcggtggcggcaccgccggtctgggcgcc
tatcgcgcggccaaacgccatacccccagcgtagtgatgattgaaggcggtccctttggc
accacctgcgcccgcgtgggctgcatgccctctaagctgctgatcgccgcggccgaatcc
gtgcatcagatcgcccgcgcacccgccttcggtatccacccccagggtgaggtccgcatt
gacggtcgagaggtgatggaccgcgtgaagcgcgaacgcgatcgcttcgtcggcttcgtc
atggagggcgtcgacagcattcccgcggatgacaaaatccttggctatgcccgctttctg
gacaatcacaccctgcaggttgctgaacatacccgtatccatgccaaacgcatcgtcatc
gccagcggctcacgcccggtatggcctgccgcttgggatgctctgggcgatcgcctgatc
gtcaacgacgatctgttcgcctgggatacgctgccgcgcgccgttgccgtcttcggcccc
ggcgtcatcggccttgagctggggcaagccctgcaccggctcggtgtcgaggtcaaggtc
ttcggcgtcggcggcgccgtcgggccgctgacggatgccgaggtccgccgctatgccgcg
gataaactgggcgcagagttttatctcgaccccgacgcacaggtagagatcctacagcgt
gagggggagcaggtcttcattcgctatcgcgatctggatggtcaaacgcaggatatcctg
gtggactacgttctggccgccaccggccgtcgtcccaacgtcgaccgcctggggctggaa
aacaccaccctacagcgagatgcccgcggcgtaccgctggcggatcgcctgacgatgcag
accaacgtcgagcatatctttattgccggcgacgccagcaaccagctgccgctgctgcac
gaggccagcgatcaggcgcgcattgccggtgagaacgccggtcgctatccccacatagcc
ccgggactgcgccgcagccccctctcggtggtcttttccgacccacagatcgcgatggtg
ggatccaccttccgcgagctgaatgagaaatatggcgcctgcggctgcttcgccgtcggg
gaggtctcatttgaaaaccagggacgatcccgcgtcatgctgcgcaacctgggcctgctg
catgtctatgctgagcagggaagcggccgcttcctcggcgcagagatgatcgggccggac
gccgagcaccttgcccacctgctctcttgggcccatcaacagcagatgaccgtagaccag
atgctggatatgccgttttaccatccggtcatcgaggaaggggtgcgtaccgccctacgc
gatctgcaaagcaaactgcgtttgggcagcgacgaaatcgagcgctgcctgcgctgtccg
ggggattaa

DBGET integrated database retrieval system