KEGG   Edwardsiella piscicida C07-087: ETAC_03215Help
Entry
ETAC_03215        CDS       T02509                                 

Definition
(GenBank) bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_03215
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_03215
   00640 Propanoate metabolism
    ETAC_03215
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     ETAC_03215
    4.2.1.99  2-methylisocitrate dehydratase
     ETAC_03215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AGH72774
Position
747617..750214
Genome map
AA seq 865 aa AA seqDB search
MLKEYREHVAERAALGVVPKPLDAAQMAALVELLKSPPAGEEALLLDLLTNRVPPGVDEA
AYVKAAFLAALVKGEAHSPLVSAAKALELLGTMQGGYNIHPLIEALDNAALAPIAVGALS
HTLLVFDSFHDVEQRARAGNAFARQVLQSWADAEWFLSRPALADTLTVTVFKVSGETNTD
DLSPAQDAWSRPDIPLHALALLKNPRDGIIPDQPGAVGPIRQLQTLAEQGYPLAYVGDVV
GTGSSRKSATNSVLWLMGEDIPFVPNKRAGGVVLGGKIAPIFFNTMEDAGALPIEVDVSQ
LQTGEVIDIYPYRGEIRRHADGALLATFALKTEVLLDEVRAGGRIPLIIGRALTARAREA
LDLPPSDVFRQPKAVSDSGKGYTLAQKMVGRACGVAGVRPGQYCEPRMASVGSQDTTGPM
TRDELKDLACLGFSADLVMQSFCHTAAYPKPIDVQTHHTLPDFIMNRGGVALRPGDGIIH
SWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGQM
QPGITLRDLVHAIPYHAIQQGLLTVEKQGKKNIFSGRILEIEGLPQLKVEQAFELADASA
ERSAAGCTIKLDREPIVEYLQSNIVLLRWMIAEGYGDRRTLERRIRAMEKWLADPQLLVA
DGDAEYAAVIEIDLDAIKEPILCAPNDPDDARLLSQVAGAKIDEVFIGSCMTNIGHFRAA
GKLLDSHQGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARVEIPGCSLCMGNQARVA
DGATVVSTSTRNFPNRLGTGANVYLASAELAAVAALLGQLPDVAQYQQFMAKVGASAADT
YRYLNFNRLTPYTEKAGQVIFQTAV
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagaataccgtgagcacgtcgccgagcgggcggccctgggtgtggttcctaag
ccgctggacgcggcgcagatggcagcgctggttgagctgcttaagtcaccgccggcgggc
gaggaggccctgctgctggatctcttgaccaaccgggtaccgccgggcgttgatgaggcg
gcctatgtgaaggcggccttcttggccgcgctggtgaagggcgaggcccactcgccgttg
gtcagcgccgccaaggcgctggagctgctgggaacaatgcagggtggctataacattcat
ccgctgattgaggcgctggataacgcggcgctggcgccgatcgccgtcggcgcactgtcc
catactctgctggtcttcgatagcttccacgacgttgagcagcgcgcgcgcgccgggaat
gcgtttgcccgccaggtgctgcagtcctgggccgatgccgaatggttcctgtcccgtccg
gcgctggcggacacgctgacggtgacggtcttcaaggtcagcggtgaaaccaataccgac
gacctgtccccggcgcaggatgcctggtcccgccccgatattccgctgcacgcgctggcg
ctgctgaagaacccgcgcgacggcatcatcccggatcagcccggcgccgtggggccgatc
cgtcagctgcagacgctggccgagcagggatacccgctggcctacgtcggcgatgtggtg
ggcaccggctcctcgcgtaaatcggcgaccaactcagtgctgtggctgatgggggaggac
atccccttcgtgcccaataagcgggccggtggcgtcgtgctgggcggtaaaatcgcgccg
atcttctttaacaccatggaggatgccggtgctctgccgatcgaggtggacgtcagccag
ctgcagaccggtgaggttatcgatatctacccctatcggggggagatccgccgtcatgcc
gacggcgccctgctggcgacctttgccctgaagaccgaggtattgctggatgaagtgcgc
gccggcgggcgtattccgctgatcatcggccgggcgctgacggcgcgcgcgcgcgaggcg
ctggatcttccgcccagcgatgtcttccgccagcccaaagcggtcagcgacagcggcaag
ggatataccctggcgcaaaaaatggtggggcgcgcctgcggcgtagccggcgtgcgtcca
ggccaatactgcgaaccgcggatggcctccgtcggctcgcaggataccactggcccgatg
acgcgtgatgagctgaaggatctggcctgcctgggtttttccgccgatctggtgatgcag
tccttctgtcacacggctgcctatcccaagcctatcgatgtgcagacgcaccacacgctg
cctgacttcattatgaaccggggcggggtggcgctgcgtccgggcgatggcatcatccac
tcctggctgaaccgaatgctgctgccggacaccgtgggtaccggcggcgactcccatacc
cgcttccctatcgggatctcgttcccggcaggatccggcctggtggcatttgccgccgcg
accggggtgatgccgctggatatgccggagtccgtcctggtgcgttttaaagggcagatg
cagccggggatcaccctgcgcgatctggtccatgccatcccctatcacgcgatccagcag
gggctgctgaccgtcgagaagcaggggaagaagaacatcttctccggacggatcctggag
atcgaagggctgccgcagctgaaggtcgagcaggcctttgagctggccgatgcctcggcg
gagcgttcggcggccggctgcaccattaagctggatcgtgagccgatcgtggagtatctg
cagtccaatatcgtgctgctccgctggatgatcgccgagggctacggcgatcgccgcacc
ctggagcgccgcatccgcgccatggagaagtggctggccgatccgcagctgctggtggcg
gacggtgacgccgagtatgccgcggtgatcgagatcgatctcgacgcgattaaagagcct
attctgtgcgcccccaacgatccggacgatgcgcgtctgctgtcacaggtggccggggcg
aagatcgatgaggtctttattggctcctgtatgaccaatattggccacttccgcgccgcc
ggtaagctgcttgatagccatcagggtcagctgccgacgcggctgtgggtggcgccgccg
acccgtatggacgccgcgcagctgacggaggaggggtactacagcgtgttcggcaagagc
ggcgcgcgcgttgagatcccaggctgttccctgtgcatgggcaaccaggcgcgggtggcc
gacggggcgacggtggtatcgacgtcgacgcgtaacttcccgaaccgcctcggcaccggc
gctaacgtctatttggcatcggccgagctggcggcggtggcggccctgctgggtcagctg
ccggacgtcgcgcagtatcagcagtttatggcgaaggtgggggcgtcggcggcagacacc
taccgctatctcaactttaatcgcctgacgccatacaccgagaaggccgggcaggtgatc
ttccagaccgcggtgtaa

DBGET integrated database retrieval system