KEGG   Edwardsiella piscicida C07-087: ETAC_03250Help
Entry
ETAC_03250        CDS       T02509                                 

Definition
(GenBank) Two-component response regulator CreB
  KO
K07663  two-component system, OmpR family, catabolic regulation response regulator CreB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_03250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_03250
Two-component system [BR:etc02022]
 OmpR family
  CreC-CreB [MD:M00449]
   ETAC_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg HTH_12
Motif
Other DBs
NCBI-ProteinID: AGH72781
Position
complement(754655..755338)
Genome map
AA seq 227 aa AA seqDB search
MPPLIWLIEDRATAADPLIYTLETEGFNVCWFNHIQPALDALKQQTPHLAIIQLTLPDGS
GLALGRHLQERHPALPLLFLASAPEEASQVSAAALPHSAVILPPFSAREICVRMRTLLPH
PEKIGAKATRLECYGNFTLNDSRGCAHYFGHALQLNHCEYLLLKTLLQGRGKVFSRSQLN
DLLRPLNEKGGERSVERHIKTLRAKLQRITPHDIPLNAHHGVGFSIE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgccaccgttaatttggcttatcgaagatcgggccaccgccgctgacccgctgatctat
acgctggaaacggaagggtttaacgtatgctggtttaaccatatccagcccgcccttgac
gcccttaaacagcaaaccccgcatttggctatcattcagctaacgttgcccgacggcagc
ggtctggcgttgggacgccacctgcaggagcgccatcccgcgctgccgctgctctttctg
gccagcgcccccgaggaagcatcgcaggtcagcgctgccgcgctgccgcacagcgccgtc
attctcccccccttttccgcccgtgaaatctgcgtgcgtatgcgtacgctgctgccgcat
ccggaaaagatcggtgccaaggcgacccgcctggagtgctatggcaactttaccctcaac
gatagccgcggctgcgcccactattttggccatgccctgcagctgaaccactgcgaatac
ctgctgctgaaaacgctgctccagggacggggaaaggtgttctcccgcagccaactgaac
gatctgctgcgtccgctgaatgagaagggcggcgaacgcagcgtcgagcgccatatcaag
acgctacgggccaaactgcagcggatcacgccccacgatatcccgctcaatgcgcaccac
ggcgtcgggttcagcatcgagtaa

DBGET integrated database retrieval system