KEGG   Edwardsiella piscicida C07-087: ETAC_03435Help
Entry
ETAC_03435        CDS       T02509                                 

Gene name
recD
Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:etc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ETAC_03435 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etc03400]
    ETAC_03435 (recD)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ETAC_03435 (recD)
DNA repair and recombination proteins [BR:etc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ETAC_03435 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 SH3_13 AAA_22 UvrD-helicase PhoH UvrD_C DUF2075 AAA_28 AAA_16 T2SSE CbiA
Motif
Other DBs
NCBI-ProteinID: AGH72818
Position
797490..799343
Genome map
AA seq 617 aa AA seqDB search
MRESLLSQMAQQRTLRPLDLQFATLLAGPQQPHLALAAALVSQELAAGHVCLPLTALDTA
TLSQRFPQQADAWPALLAGWDVARWRDYLLAQPCVSGGDRATPLVVSHDCLYLQRLWRDE
GTVAAFFAAACAQPRRVDGALAPVLHRLFPATAQRPDWQQVAAAVAVTRRASVISGGPGT
GKTTTVARLLAALVALAPGRMPRIQLAAPTGKAAARLGESLGQALAALALAPDQLQAMPR
EALTLHRLLGARADSARLRYHRDNPLHLDVLVVDEASMVDLPMMARLIEALPPQAQLILL
GDRDQLASVEAGAVLGELCRFAEYGFSAARAAELSQLCDAPIPAGETQPAVALRDAISLL
RHSYRFDARSGIGQLALAVNRGDRRMAMACLADRFADLHWHEIAQDEDYQTLLTCCLAGY
RPMLEGILRGEAPAQILAEFARFRPLCALREGPFGLHGLNERIALTLQRAGLIRRAHEGQ
KHWYAGRPVMITRNDASQALFNGDIGITLGDEQSGWQVWFMGSDGAPRAVQPNRLPPHET
AWAMTVHKSQGSEFDHTLLALPTQPSPVVTRELVYTAITRARQQLTLFATRPVLERAIRT
PTERRSGLMARLLAAAD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtctctactctcccagatggcgcagcagcgtacgctgcgcccgctggatctg
cagtttgccacgctgttagccgggccgcagcagccgcacctggcgctggccgcggcgctg
gtcagccaagagctggccgccgggcatgtctgcctgccgctgacggcgctggatacggcg
acgctgagccagcgctttccgcagcaggccgatgcgtggccagcgctgctcgccgggtgg
gacgttgctcgctggcgggactacctgctggcgcagccctgcgtcagcggtggcgatagg
gcgacgccgctggtggtcagccacgattgcctgtatctacagcgactatggcgtgatgag
ggcacggtggcggcctttttcgccgcggcctgtgcgcagccgcggcgcgtcgatggcgcg
ctggcgccggtgctgcaccgtctgttcccagccacggcccagcggccggactggcagcag
gtggccgcggccgtggcggtgacgcgccgggcgtcggtgatctccggcgggcccggcacc
ggtaaaaccacgaccgtagcgcgcctgctggcggcgttggtcgcgctggcgcccggtcgg
atgccgcgtattcagttggcggcgccgacgggcaaggcggcggcgcgtctgggtgagtcg
ctggggcaggccttggcggcattggcgctggcgccggatcagctgcaggcgatgccgcgc
gaagcgctgacgctgcatcggctgctgggtgcccgggcagacagcgcccgcttgcgctat
caccgggataatccgctgcatctggatgtgctggtggtggatgaggcttcaatggtggat
ctgccgatgatggcgcggctgatcgaggcgttgccgccgcaggcgcagctgatcctgctg
ggggatcgcgatcagctggcgtcggtggaggccggcgcggtgctgggtgagctgtgccgc
tttgccgaatatggcttcagcgccgcgcgcgcggccgagctgagccagctgtgcgatgcg
ccgatccccgccggagagacgcagccagcggtcgccctgcgtgacgccatcagcctgctg
cgtcacagctaccgcttcgacgcccgttcagggatcgggcagctggcgctggccgtcaat
cggggcgatcgccggatggctatggcgtgtctggcggaccgctttgccgatctgcattgg
cacgaaatcgctcaggatgaagactaccagacgctcttaacgtgctgtctggcggggtat
cgcccgatgctggaggggatcctgcgcggggaggccccggcgcagatcctggccgaattt
gcccgcttccgtccgctgtgcgccctgcgcgaggggccctttggcctacatggtctcaac
gagcgtatcgctctgacgctgcagcgggcggggctgatccggcgcgcgcatgaggggcaa
aagcactggtatgccgggcgtccggtgatgatcacccgcaacgacgccagtcaggcgctg
tttaacggcgatatcggtattacgctgggcgatgaacagagcggctggcaggtgtggttt
atgggcagcgacggcgcgccgcgcgcggtacagcccaaccgtctaccgccccatgagacg
gcctgggcgatgacggtgcacaagtcgcagggatcggagttcgaccatacgctgctggcg
ctgccgacccaaccgtcgccggtggtgacgcgtgagctggtgtataccgccatcacgcgg
gcgcgccagcagctgacgctctttgcgacccggccggtgctggagcgggccatccgtacg
ccgaccgaacggcgcagcgggctgatggcccgtctgctggccgccgccgattaa

DBGET integrated database retrieval system