KEGG   Edwardsiella piscicida C07-087: ETAC_03440Help
Entry
ETAC_03440        CDS       T02509                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ETAC_03440
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     ETAC_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: AGH72819
Position
complement(799365..800690)
Genome map
AA seq 441 aa AA seqDB search
MKERSTELVQGFRHSVPYINAHRGKTFVIMLSGEAIAEANFVGIINDIALLHSLGIRLVV
VYGARPQIDTLLREQRCDPRYHKQTRVTDARTLALVKQAAGQVQLDITARLSMSLSNTPL
AGAHINVVSGNFVIAQPLGVDDGVDYCHSGRIRRIDEAALRCQLDAGAIVLLGPVAVSVT
GESFNLTTEEIATHLAIKLQAEKLIGFCAAQGVSNDDGSIAAELLPNEAERRVAALEATG
EGALSSTRFLRGAIAACRSGVGRSHLISYLEDGALLQELFSRDGIGTQIVMESAEQIRRA
NINDIGGILALIRPLEQQGILVRRSREQLEREIERFTLIERDSLTIACAALYPFPQERMG
EMACVAVHPDYRNSARGEQLLQRITAQARQMGLEKLFVLTTRSLHWFQERGFQPVEVDML
PQQKQALYNYQRRSKILLTEL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgcagcacagaactggttcaggggtttcgccactcggtgccgtacatcaat
gcccaccgcggcaagacctttgtcattatgctgagcggcgaggccatcgccgaggcgaac
ttcgtcggcatcatcaacgatatcgcgctgctgcatagcctgggcattcgtctggtcgtg
gtctacggcgcccgcccacagatcgatacgcttctccgagagcagcgctgcgatcctcgc
taccacaagcagacccgggtcacggatgcccgtacgctggcgctggtcaaacaggccgcg
gggcaggttcagctggatatcaccgcgcgcctgtcgatgagcctgagcaatacgccgctg
gccggcgcgcacatcaacgtggtcagcggtaactttgtcatcgcccagccgctgggggtc
gatgacggcgtggactattgccacagcgggcgcattcgccgcattgatgaggccgcgctg
cgctgtcagctggacgccggcgctatcgtcctgctcggtccggtggcggtgtcggtcacc
ggagagagctttaacctcaccactgaagagatcgccacccacctggccatcaagctgcag
gcggagaagctgatcggtttctgcgccgcgcagggggtcagcaacgacgacggcagcatc
gccgccgagctgctgcccaacgaggccgagcggcgcgtcgcggcgctggaggccaccggt
gagggggccctgagcagcacgcgctttctgcgcggtgcgatcgccgcctgtcgcagcggc
gtaggccgcagccacctgataagctacctggaagacggcgctctgctgcaggagctgttc
tcgcgcgacggcatcggcacccagatcgtgatggagagcgcagagcagatccgccgcgct
aacatcaatgatatcggcggcattctggccctgatccgcccgctggagcagcaggggatc
ctggtgcgtcgctcgcgcgaacagctggagcgagagatagagcgctttaccctgatcgag
cgcgatagcctgactatcgcctgcgccgcgctctaccctttcccccaggagcgcatgggc
gagatggcctgcgtggcggtgcatccggactaccgcaactctgcgcgcggagagcagctg
ctgcagcgaattaccgcgcaggcgcgtcagatggggctggagaagctgtttgtcctgacg
acccgcagcctgcactggtttcaagagcgcggcttccagccggtagaggtcgatatgctg
ccgcagcagaagcaggcgctgtataactaccagcgccgctccaaaatcctgctgaccgag
ctgtag

DBGET integrated database retrieval system