KEGG   Edwardsiella piscicida C07-087: ETAC_03480Help
Entry
ETAC_03480        CDS       T02509                                 

Definition
(GenBank) 23S rRNA C2498 ribose 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
etc  Edwardsiella piscicida C07-087
Brite
KEGG Orthology (KO) [BR:etc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:etc03009]
    ETAC_03480
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ETAC_03480
Ribosome biogenesis [BR:etc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ETAC_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AGH72827
Position
808416..809525
Genome map
AA seq 369 aa AA seqDB search
MYCRPGFEKECAAEITDKAAALEVYGFARVKENSGYVLFECYQPEDADKLARKLPFRELI
FARQMLVVGELLKDLPPEDRIAPICGMLLGVVDGGGELRVEVPDTNESKELLKFCRKFTV
PLRAALREQRTLLRQENPYRPVVHVLFIAPGCCYVGYSYSDNNSPFYMGIPRLKFPADAP
SRSTLKLEEAFHVFIPADEWDERLGSGMRAVDLGACPGGWTYQLVQRSMMVQAIDNGPMA
PSLMDTGQVTHHRADGFRFTPEGDNDWLVCDMVEKPAKVSALMARWLVNGWCREAIFNLK
LPMKKRYEEVSQNLATLAQVLKENGINAQIAAKQLYHDREEVTVHIRRIWGAIPGRRDER
EFRRREQRD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgtattgccgtcctggctttgagaaagagtgtgcggcggagatcaccgataaggcggcg
gcccttgaggtgtacggttttgcccgggtgaaagagaacagcggctacgtgctgttcgag
tgctatcagccggaggatgcagacaaactggcgcgcaagctgccgttccgagagctgatc
tttgcccgtcagatgctggtggtcggcgagctgctgaaggatttgccgccggaggatcgc
atcgcgccgatctgcggcatgctgctgggggttgtcgatggcggcggtgagctgcgcgtc
gaggtgccggacaccaacgaaagcaaagagctgctgaagttctgccgcaagttcaccgtg
ccgctgcgcgcggcgctgcgggagcagcgtactctgctgcgccaggagaacccctatcgt
ccggtggtgcacgtgctgtttattgcgccgggctgctgctatgtcggctactcgtatagc
gataataactcgccgttttacatggggatcccgcgcctgaaatttcctgccgacgccccc
agtcgctctaccctcaagctggaggaggcattccacgtctttattcccgccgatgagtgg
gatgagcgtctgggcagcggcatgcgcgccgtcgatctgggggcttgccccggcggctgg
acctatcagctggtgcagcgcagcatgatggtgcaggccatcgacaatggcccgatggcg
ccgagcctgatggataccgggcaggtgacccatcaccgcgccgatggcttccgctttacg
ccggagggggataacgactggctggtgtgcgatatggtcgagaagccggccaaggtttcg
gcattgatggcgcgctggctggtcaacggctggtgtcgggaggctatcttcaacctgaag
ctaccgatgaagaagcgctacgaagaggtgagccagaatttggccacgctggcgcaggtg
ctgaaagagaacggcatcaatgcgcagattgcggccaagcagctgtatcacgatcgcgaa
gaggtgacggtgcacattcgacgcatctggggcgccattcccggtcgccgcgacgagcgg
gagttccgccgccgcgaacagcgcgattaa

DBGET integrated database retrieval system