KEGG   Edwardsiella piscicida C07-087: ETAC_03545Help
Entry
ETAC_03545        CDS       T02509                                 

Gene name
dapD
Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_03545 (dapD)
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     ETAC_03545 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THDPS_N_2 Hexapep_2 Hexapep
Motif
Other DBs
NCBI-ProteinID: AGH72840
Position
complement(818586..819410)
Genome map
AA seq 274 aa AA seqDB search
MQQLQTVIENAFERRAEITPANADSITREAVSQVIALLDSGALRVAEKINGEWVTHQWLK
KAVLLSFRINDNRLMEGAETRFYDKVPMKFADYDEARFQREGFRVVPPASVRQGAFIARN
TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED
NCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVVSGNLPS
KRGDYSLYCAVIVKKVDAKTLGKVGINELLRTID
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagttacagacagttatcgaaaacgcctttgagcgccgcgccgagatcaccccg
gccaacgccgacagcatcacccgtgaagccgtcagccaggtcatcgccctgctcgacagc
ggcgccctgcgcgttgcagaaaaaattaacggcgagtgggtcacccaccagtggctgaag
aaggcggtgctgctctctttccgcattaacgacaaccgcctgatggaaggcgcagaaacc
cgtttctacgacaaagtgccgatgaagttcgccgactatgacgaagcccgcttccagcgc
gagggcttccgcgtcgtaccgccggcctccgttcgccagggggccttcatcgcccgcaat
accgtactgatgccctcctacgtcaacattggcgcctacgttgacgaaggcaccatggtc
gatacctgggccaccgtcggctcctgcgcccagatcggtaaaaacgttcacctctccggc
ggcgtcggcatcggcggcgtactggagccgctgcaggccaacccgaccatcatcgaagat
aactgcttcatcggcgcccgctctgaagtggtcgaaggggttatcgtggaagagggctcg
gttatctcgatgggggtctttatcggacagagcaccaagatctatgaccgtgaaaccggc
gaggttcactacggtcgtgtaccggccggctccgtggtcgtctccggcaacctcccctct
aaacgcggcgactacagcctgtactgcgcggttatcgtcaagaaagtggatgccaagacg
ctcggcaaggtcggcatcaacgagctgctgcgcaccatcgactaa

DBGET integrated database retrieval system