KEGG   Edwardsiella piscicida C07-087: ETAC_03550Help
Entry
ETAC_03550        CDS       T02509                                 

Definition
(GenBank) PII uridylyl-transferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_03550
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     ETAC_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase ACT HD DUF294 NTP_transf_2
Motif
Other DBs
NCBI-ProteinID: AGH72841
Position
complement(819485..822139)
Genome map
AA seq 884 aa AA seqDB search
MAELSHGEPDALPPVSPDTLPADALTCTGLKPHMEQLRRWLDHAFRRGESAESLVAARTH
YIDRLLVRLWRSYGFDTQPGLALIAVGGYGRAELHPLSDIDLLLLSAEPLAPAQEAQLGA
LITLLWDLRLEVGHSVRTLAQCLSEGLADLTVATNLIESRLLSGDVALFLQLQKQLFSDD
FWPSPRFYHAKVNEQRERHQRYHGTSYNLEPDIKASPGGLRDIHTLLWVAHRHFGATSLD
EMVGFGYLTSAERDELNECRSFLWRIRFALHLVVNRYDNRLLFDRQLSVARLLGYQGEGN
APIEKMMKEFYRMTRRVRELNQMLLQLFDEAILALDTREKPRILDDYFQLRGPLIDLRDP
DTFSHDPVIILRLFYAMARNPEIEGIYSTTLRQLRYARRHLKQPLCALPEARSLFMAILR
HPGAVRRALLPMHHHSVLWAYMPQWGKIVGQMQFDLFHAYTVDEHTMRVLLKLESFADRD
NHGRHPLCVELYPRLPQPELLLLAALFHDIAKGRGGDHSLLGADDVLEFARLHGLNTRET
QLVAWLVRCHLLMSVTAQRRDIQDPEVIRHFCAEVHSETRLRYLICLTVADICATNENLW
NSWKQSLLRELFFASEKQLRRGMHSSPDMRERVRHHRLQALALLRMDNIDEPGLMRLWGR
CRADYFLRHTPSQLAWHARHLLRHRGDGPLVLVSQHATRGGTEIFIYSPDRPYLFAAVAG
ELDRRNLSVHDAQIFTNRDNYAMDTFVVLEPDGSPLAPDRHDTIRQALEHALTQPHYHPP
RARRAPARLRHFSVPTEVSFLPAHNARRSYMELVALDRPGLLAHIGEIFAEMGLSLHGAR
ITTIGERVEDLFILADGERRALTPEMQRELAQRLTETLLSADKG
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttatcgcacggcgaaccggacgccctgccgcccgtatcgccggacaccctc
cccgccgacgcgctgacctgcaccgggctaaagccccacatggagcagctgcgtcgctgg
ctggatcacgcctttcgccgcggcgaaagcgccgagtcgctggttgccgcccgtacccac
tatatcgaccgtctgctggtgcgcctgtggcgcagctacggcttcgacacccagcccggc
ctggcgctgatcgccgtcggcggctatggccgcgcggagctgcacccgctatcggacatc
gacctgctgctgctcagcgccgaaccgctggcgccagcgcaggaggcgcagcttggcgcg
ctcataaccctgctatgggacctgcgtctggaggtcggccacagcgttcgtaccctggcg
cagtgcctgagcgaggggctggccgatctgaccgtcgccaccaacctgatcgaatcccgc
ctgctgagcggcgacgtcgccctgtttctccagttacaaaaacagctattcagcgacgac
ttctggccctcgccgcgcttttaccacgccaaggtgaacgaacagcgcgagcgccaccag
cgctatcacggcaccagctataatctggagccggacatcaaggccagccccggtggcctg
cgcgatattcacaccctgctgtgggtagcccatcgccactttggtgccacctccctcgat
gagatggtcggcttcggctacctgacgagcgccgagcgcgacgagctgaacgaatgccgc
agcttcctgtggcgcatccgcttcgccctgcatctggtggtcaaccgctacgacaaccgc
ctgctgttcgatcgccagctcagcgtcgcccgcctgctgggctatcagggcgaaggcaac
gcgcctatcgaaaagatgatgaaagagttttaccgcatgacccggcgggtgcgtgagctg
aaccagatgctgctacagctgttcgatgaggcgatcctcgcgctggacacccgggaaaaa
ccacgcattctcgacgactacttccagctgcgcggccccctgatcgatctgcgcgatccg
gacaccttcagccacgatccggtaattattctgcgattgttctacgccatggcgcgcaat
ccggagatcgagggcatctactccaccacgctgcgtcagctgcgctacgcgcgccgccat
ctgaagcaaccgctgtgcgccctgcccgaggcacgcagcctgttcatggcgatcctacgc
caccccggcgcggtgcgacgcgcgctgctgcccatgcaccatcacagcgtactgtgggcc
tatatgccgcagtgggggaagatcgtcggccagatgcagtttgatctgttccacgcctac
accgtggacgagcacaccatgcgggttctgctcaagctggagagctttgccgatcgggat
aaccacgggcgccacccgctgtgcgtcgagctctacccgcgcctgccgcagccggagctg
ctgctgctcgccgccctgttccacgatatcgccaaagggcgcggcggtgaccactccctg
ctcggcgccgacgacgtgctggagtttgcccgtctgcacggccttaacacgcgcgaaacc
cagctggtggcctggctggtacgctgccatctgctgatgtcggtcaccgctcagcgccgc
gacattcaggatcccgaggtcattcgccacttctgtgcggaggtgcacagcgaaacccgg
ctgcgctatctgatctgcctgacggtcgccgacatctgcgcgaccaacgaaaacttgtgg
aacagctggaagcagagcctgctgcgcgagctgttcttcgccagcgaaaaacagctgcgc
cgcggtatgcacagcagcccggacatgcgcgagcgggtacgccatcaccggctgcaggcg
ctggcgctgctgcggatggacaacatcgacgaaccggggctgatgcggctgtggggccgc
tgccgcgcggactacttcctgcgccatacgcccagccaactggcgtggcacgcccgccac
ctgctgcgccaccgcggcgacggccccctggtgctggtcagtcagcatgccacccgcggc
ggtaccgaaatcttcatctacagccccgatcggccttatctgtttgccgccgtcgccggt
gagctggatcgacgcaatctcagcgtacacgacgcccagatcttcaccaatcgcgataac
tatgccatggacaccttcgtggtgctggagccagacggcagtccgctggcgccagatcgc
cacgacaccatccgccaggcgctggagcatgcgctgacgcagccgcactatcacccgccg
cgtgcgcgccgcgcgccggcgcgtctacgccacttcagcgttccgacggaggtcagcttt
ctgccagcccataacgcccggcgcagctacatggagctcgtcgcgctcgatcgtccgggg
ctgctggcccatatcggcgagatctttgccgaaatgggcctctcgctgcacggcgcccgc
attaccaccattggcgagcgggtcgaggatctgtttattctggccgacggcgaacggcgc
gcattaacgcctgaaatgcagcgggagctggcgcaacggttgacagaaaccctgcttagc
gccgataaagggtag

DBGET integrated database retrieval system