KEGG   Edwardsiella piscicida C07-087: ETAC_03615Help
Entry
ETAC_03615        CDS       T02509                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00780  Biotin metabolism
etc01100  Metabolic pathways
etc01212  Fatty acid metabolism
Module
etc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_03615
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAC_03615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_03615
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ETAC_03615
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AGH72854
Position
835655..836110
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLNISEILELLPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVHPGDQMILEVEFLKE
RRGVARFNGVAKVDGKIVCEASMMCARNREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctcaatatttcagagattttagagcttctgccgcaccgt
tttccgttcctgctggtggatcgtgtgctggattaccaagagggcaaattcctgcgtgca
gtgaagaacgtctcctttaacgagccgtttttccagggacacttcccgggcaaaccgatt
ttccccggggtgctgatcctcgaagccatggcgcaggccaccggtattctggcctttaag
agcgtgggtaaactggagccgggcgaactgtactactttgccggtatcgatgacgcccgc
tttaagcgtccggttcatccgggtgaccagatgatcctggaagtggagtttctgaaagag
cgccgcggcgtggctcgctttaacggtgttgccaaggttgacggcaagatcgtgtgcgag
gcgtccatgatgtgcgcccgtaaccgtgaggcctga

DBGET integrated database retrieval system