KEGG   Edwardsiella piscicida C07-087: ETAC_03640Help
Entry
ETAC_03640        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_03640
   00640 Propanoate metabolism
    ETAC_03640
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_03640
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     ETAC_03640
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ETAC_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE Med9 Gp-FAR-1
Motif
Other DBs
NCBI-ProteinID: AGH72859
Position
842234..843193
Genome map
AA seq 319 aa AA seqDB search
MSLNFLDFEQPIAELEAKIDSLNALSRQDEKLDINIDEEVQRLREKSVELTRKIFADLGA
WQIAQLARHPRRPYTLDYIQHIFTDFDELAGDRAYADDKAIVGGTARLDGRPVMVIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMELAERFNLPIVTFIDTPGAYPGVGAEERGQSEA
IARNLREMSGLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGITAPRLQELKLIDSVIPEPLGGAHRDPQTMAASLKAQLLTDLADLDTL
EKEELLDRRYQRLMNYGYC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaattttctggattttgaacagccgattgccgaacttgaagcgaagatcgat
tcgctgaacgctctcagccgtcaagacgaaaaattggatattaatatcgacgaggaggtc
cagcgcctgcgtgagaagagcgttgagctgacccgtaagatttttgccgatctgggagcc
tggcagattgcccagctggcgcgtcatccgcgtcgcccctataccctggattatattcag
catattttcaccgacttcgatgagctggccggcgatcgcgcctacgccgacgacaaggcc
attgtcggtggtacggctcgtctggacggccgtccggtgatggtgattggccatcagaaa
ggacgcgagaccaaagagaagatccgccgtaacttcggcatgccggcgccggagggctac
cgcaaggcgctgcgcctgatggagctggcggagcgctttaacctgccgatcgtcaccttt
atcgatacgccgggcgcctatccgggcgtgggcgcggaagagcgtggccagtctgaggct
atcgcacgtaacctgcgcgagatgtctgggctgaaggtgccggtcatctgtacggtcatc
ggcgaaggcggctccggcggcgcgctggctatcggcgttggcgataaagtcaacatgctg
cagtacagcacctactccgtgatctcaccggagggatgcgcatccatcctgtggaagagc
gccgacaaggcaccgctggccgcggaagcgatgggtatcaccgcgccgcgcttgcaggag
ctgaagctgatcgactcggtgattccggagccgctgggcggcgctcatcgcgatccgcag
acgatggcggcgagcctgaaggcgcagctgctgaccgatctggcggatctggataccctg
gaaaaagaagagctgctcgatcgtcgctatcagcgtctgatgaactacggttactgctga

KEGG   Edwardsiella piscicida C07-087: ETAC_11425Help
Entry
ETAC_11425        CDS       T02509                                 

Definition
(GenBank) Acetyl-coenzyme A carboxyl transferase beta chain
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_11425
   00640 Propanoate metabolism
    ETAC_11425
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_11425
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     ETAC_11425
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ETAC_11425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DZR Auto_anti-p27 Tmemb_55A OrfB_Zn_ribbon Zn-ribbon_8 zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: AGH74406
Position
complement(2591860..2592768)
Genome map
AA seq 302 aa AA seqDB search
MSWIERILNKSNISQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTAR
MRLNTLLDDGSHVELGSELEPKDILKFKDSKKYKDRLAAAQKETDEKDALVVMKGTLHGM
PVVAASFEFSFMGGSMASVVGSRFVRAVEQALEDNCALICFSASGGARMQEALMSLMQMA
KTSAALAKMRERGLPYISVLTDPTMGGVSASLAMLGDINIAEPKALIGFAGPRVIEQTVR
EKLPAGFQRSEFLLEKGAIDMIVRRPAMRDKLACLVAKMTGRPDPLDDGTQQAASAESSA
QA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgcattcttaacaagagcaatatctctcaaacccgtaaggcaagc
attccggagggcgtctggaccaagtgcgacagctgtggtcaggtgctttaccgtgccgag
ctggagcgtaatctggaggtctgccccaagtgcgaccaccacatgcgtatgacggcgcgc
atgcgcctgaatacgctgctggatgacggcagccacgtcgagctgggcagcgagctggag
ccgaaggatatcctgaagttcaaagactccaaaaagtataaggatcgcctggccgccgct
cagaaagagaccgacgaaaaagatgcgctggtggtgatgaaaggtaccctgcatgggatg
ccggtggtggccgcctcgtttgagttttcctttatgggtggctccatggcctccgtggtc
ggctcacgctttgtccgcgccgttgaacaggcgctggaggacaactgcgccctgatctgc
ttctccgccagcggcggcgcccgtatgcaggaggcgctgatgtcgctgatgcagatggcg
aagaccagcgcggcgctggccaagatgcgcgagcgcggcctgccctatatctccgtgctg
accgatccgaccatgggcggcgtctccgccagtctggccatgctgggcgatatcaatatc
gccgagccgaaggcgctgatcggcttcgccggcccgcgcgtgattgagcagacggtgcgg
gaaaagctgccggcgggcttccagcgcagtgagtttttgctggagaaaggggccatcgat
atgatcgtgcgccgtccggcgatgcgcgataagctggcctgtctggtggcgaagatgacc
ggtcgtccggatccgctggacgacggtacccaacaggctgctagcgcggaaagcagcgcg
caggcgtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_14995Help
Entry
ETAC_14995        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_14995
   00640 Propanoate metabolism
    ETAC_14995
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H YqfD
Motif
Other DBs
NCBI-ProteinID: AGH75120
Position
3396456..3396920
Genome map
AA seq 154 aa AA seqDB search
MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAAMPAMQPFYAAAPAPVAAPVAAA
PAAAAPAAADNGSAALSGHVVRSPMVGTFYRTPSPEAKAFVEVGQKVNAGDPLCIVEAMK
MMNQIEADKSGVVKAILVENGQPVEFDEPLVVIE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgtaaaatcaagaaactgatcgaactggttgaagaatccggcatcgccgag
ctggaaatctctgaaggtgaagaatcagtacgcatcagtcgtgccccggccgccatgccg
gccatgcaaccgttctacgccgcagccccggctccggttgctgccccggtcgccgccgca
cccgccgcggcagccccggccgccgccgacaacggcagcgcggccctgagcggccatgtc
gtccgttctccgatggtcggtactttctaccgcaccccgagcccggaggccaaagcgttc
gtcgaagtgggccagaaggtcaacgccggcgatccgctgtgcatcgttgaagcgatgaaa
atgatgaaccagatcgaagccgataagtccggcgtcgttaaggcgatcctggtagaaaac
ggtcaaccggttgagtttgacgagccgttggtggtcatcgaataa

KEGG   Edwardsiella piscicida C07-087: ETAC_15000Help
Entry
ETAC_15000        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_15000
   00640 Propanoate metabolism
    ETAC_15000
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_15000
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ETAC_15000
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ETAC_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4 SspH
Motif
Other DBs
NCBI-ProteinID: AGH75121
Position
3396931..3398280
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETICIGPAQSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPKAETIRLMGDKVSAI
SAMKKAGVPCVPGSDGPLDDDMDKNRAFAKRIGYPVIIKASGGGGGRGMRVVRSDKDLAQ
SILMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQHEVQVRGHAIECRINAEDPKSFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALAELIIDGIKTNIEL
QQSIMNDANFQAGGSNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaaattgttatcgctaaccgtggtgaaatcgccctgcggatcctgcgcgcc
tgtaaggagctggggatcaaaaccgtagcggtgcactccacggcggatcgcgatctaaaa
cacgtactgctggcggacgaaaccatctgtatcggcccggcgcagtccgttaaaagttac
ctcaatatcccggccatcatctccgcggcggaaatcaccggcgcggtggcgatccatccg
ggatacgggttcctgtctgaaaacgccgacttcgccgaacaggtggagcgttccggtttt
atcttcatcggccccaaagcggagaccatccgtctgatgggggacaaagtctctgccatc
agcgcaatgaagaaagccggcgtgccgtgcgttcccggctccgatggcccgctggacgac
gacatggataaaaaccgtgccttcgccaagcgcatcggctatccggtgatcatcaaggcc
tccggcggcggcggcggtcgcggcatgcgcgtcgtacgcagcgataaggatctggcccag
tcgatcctgatgaccaaggcggaagccaaagcggcgttcaacaacgacatggtctacatg
gagaagtacctggagaatccgcgccacatcgagatccaggtactggccgacggccagggc
aacgccatctatctggccgagcgcgactgctccatgcagcgccgccaccagaaagtggtg
gaagaggcgccggcaccgggcattacgccggagctgcgtcgctacatcggcgaacgctgc
gccaaggcctgcgtcgatatcggctaccgcggcgcgggtacctttgaattcctgtttgag
aacggcgagttctatttcattgaaatgaacacccgtatccaggttgagcatccggtgacc
gagatgatcaccggggtggatctgatcaaagagcagctgcgtatcgccgccggtcagccg
ctgtccatcaaacagcacgaggtgcaggtgcgcggtcacgcgatcgaatgccgcatcaac
gccgaagatccgaagagcttcctgcccagcccgggtaagatcacccgcttccatgcgccg
ggcggcttcggcgttcgctgggagtcccatatctacgccggttataccgtaccgccgtac
tatgactccatgatcggcaagcttatctgctacggtgaaaaccgtgacgtggccatcgcc
cgcatgaagaatgcgctggcggagctgatcatcgacggcatcaagaccaacatcgagctg
cagcagtcgatcatgaacgatgccaacttccaggccggcggtagcaacattcactacctg
gagaaaaagctgggcctgcaggagaagtaa

DBGET integrated database retrieval system