KEGG   Edwardsiella piscicida C07-087: ETAC_03750Help
Entry
ETAC_03750        CDS       T02509                                 

Definition
(GenBank) sensory histidine kinase GlrK
  KO
K07711  two-component system, NtrC family, sensor histidine kinase GlrK [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00502  GlrK-GlrR (amino sugar metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_03750
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_03750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_03750
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_03750
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_03750
Protein kinases [BR:etc01001]
 Histidine kinases
  NtrC family
   ETAC_03750
Two-component system [BR:etc02022]
 NtrC family
  GlrK-GlrR [MD:M00502]
   ETAC_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2 ORF6N CHASE3
Motif
Other DBs
NCBI-ProteinID: AGH72881
Position
866086..867501
Genome map
AA seq 471 aa AA seqDB search
MPWPLFPRSLRQLVLLAFLLVLLPLLVLAYQAYQSLNHLSAQAADINHTTLSDARRSEAM
AALALEMERSYRQYCVLGDETLAALYQRQHAQYRQLLERHAALLPGGSDYAQLDSLLRQL
AAPRCENSMPLAIADGQLAQFSRANGAMVQATRNVLFGRGQQLQQAIAERGRYFGWQALV
LFLVSVLLVALFTRMIIGPVKGVERMIRRLGEGLSLQACPPFRGPREIRTLAQRILWLSD
RLAWLESQRHEFLRHLSHELKTPLASLREGTELLADGVAGPLSADQREVVAILDDSSRRL
QVLIEQLLDYNRRLADAPPESAQLDLAALLERVVAAHRLPARAKNIQTRYALDETHCRAQ
PVLLERVLENLYSNAVHYGAESGTIWLRTRREGERLVIEVANSGAPIPANEHAMIFEPFF
QGSHQRKGAVKGSGLGLSIARDSLRRMHGDLRLVADADADVCFRIELPIAR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggcccctgtttccccgttcgctgcgccagctggtgctgttggcctttctgctg
gtgctgctgcccctgctggtgctggcctaccaggcctaccagagtctgaatcacctgagc
gcccaggcggcggatatcaaccataccaccctgagcgacgcccgccgcagcgaggcgatg
gccgcgctggcgctggagatggagcgtagctatcgtcagtactgcgtgctgggggatgag
acgctggcggcgctgtatcagcgtcagcacgcccagtaccgtcagctgctggagcgccac
gccgcgctgctgcccggcggcagcgactacgcgcagctggatagcctgctgcggcagctg
gccgcgccgcgctgtgagaacagcatgccgctggcgatcgccgacggccagctggcccag
ttttcccgcgccaacggcgcgatggtgcaggcgacccgtaacgtgctgtttggccgaggc
cagcagctgcagcaggcgatcgccgagcgcggccgctactttggctggcaggcgctggtg
ctgtttctggtcagcgtgctgctggtggcgctgtttactcgcatgatcatcggcccggtg
aagggggtagagcgcatgatccggcgcctgggggaggggctgagcctgcaggcgtgtccc
ccctttcgcgggccgcgtgaaattcgtacgctggcgcagcgcattctgtggctcagcgat
cggctggcctggctggagtcccagcgccatgagtttttgcgccatctctcccatgagcta
aagaccccgctggccagcctgcgagagggcaccgaactgctggcggacggggtcgccgga
ccgctgagcgcggatcagcgcgaggtggtggcgattctggatgacagcagccgccgcctg
caggtgctgatcgaacagctgctggactataaccgccgcctggccgatgcgccgccggag
tccgcccagctggatctggccgcgctgctggagcgggtggtcgccgcccaccgcctgccg
gcgcgggccaagaatatccagacgcgctacgcgctggatgagacccactgccgcgcgcag
ccggtgctgctggagcgggtgctggagaatctctattccaatgcggtgcactatggcgcg
gaatccggtaccatttggctgcgcactcgcagggaaggggagcgtctggtgatcgaggtc
gccaacagcggtgctccgatcccggccaacgagcacgcgatgatttttgagccttttttt
caggggagtcatcagcgcaaaggcgccgtcaagggcagcggcctcggcctgagcatcgcc
cgcgattcgctgcgccggatgcacggcgatctgcgcctggtcgccgacgccgatgccgac
gtctgcttccgcattgaactcccgatagcgagataa

DBGET integrated database retrieval system