KEGG   Edwardsiella piscicida C07-087: ETAC_03760Help
Entry
ETAC_03760        CDS       T02509                                 

Definition
(GenBank) response regulator GlrR
  KO
K07715  two-component system, NtrC family, response regulator GlrR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00502  GlrK-GlrR (amino sugar metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_03760
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_03760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_03760
Two-component system [BR:etc02022]
 NtrC family
  GlrK-GlrR [MD:M00502]
   ETAC_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 AAA_5 AAA AAA_16 FAD_binding_2 ATP-grasp_4 OKR_DC_1_N AAA_30 AAA_3 IstB_IS21 AAA_2 HTH_8 UPF0175
Motif
Other DBs
NCBI-ProteinID: AGH72883
Position
868239..869579
Genome map
AA seq 446 aa AA seqDB search
MTSAHSASLLLVDDDPSLLKLLGMRLSSEGFRVTTAASGQEALRLLARDPIDLVISDLRM
DEMDGLALFSEIQRRQPGLPVIILTAHGSIPDAVAATQQGVFSFLTKPVDRDALYRAIDD
ALAQSMPQGGDDAWRQAFVTRSPLMLRLLEQARMVAQSDVSVLINGQSGTGKELLARAIH
RASPRAGKAFIAINCGALPEQLLESELFGHAKGAFTGAVSSREGLFQAAAGGTLFLDEIG
DMPLTLQVKLLRVLQERKVRPLGSNRDLDIDVRIISATHRNLPKAMELGEFREDLFYRLN
VVSLRLPALNQRPEDIPLLAAHLLRQAAERHKPLVRSFSSGAMKALMSASWPGNVRQLVN
VIEQCVALTTAPVIGEALVEQALQGENTALPTFVEARHHFELHYLRKLLQITKGNVTHAA
RMAGRNRTEFYKLLSRHELDPNDFKE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacatccgcccactctgccagcctgctgctggtcgatgatgatcccagcctgctgaag
ctgctgggcatgcgcctgagcagcgaggggtttcgggtaacgaccgccgccagcggccaa
gaggcgctgcgtctgttggcccgcgatcccatcgatttggtgatcagcgatctgcgcatg
gacgagatggatggcctggcgctgttcagcgaaattcagcgacgtcagccggggctaccg
gtgatcattctgactgctcacgggtcgataccggacgccgtggcggccacccagcagggg
gtcttcagcttcttgaccaagccggtcgatcgcgacgccctgtaccgcgccatcgacgat
gcgctggcgcagtcgatgccgcaggggggcgatgacgcatggcgtcaggcatttgtgacc
cgtagcccgctgatgctgcgtctgctggagcaggcgcgcatggtggcccagtcggacgtc
agcgtcctgatcaacggccagagcgggaccggcaaagagctgctggcgcgggcgatccac
cgcgccagtccgcgcgccggaaaggcctttatcgccatcaactgcggcgcgctgccggag
cagctgctggagtcagagctgtttggccatgccaagggcgcctttaccggcgccgtcagc
agccgtgaagggctgtttcaggccgccgccggcggcacgctgtttctggatgagatcggc
gatatgcccctgacgctgcaggtgaagctgctgcgggtgctgcaggagcgtaaggtacgt
ccgctgggcagcaaccgcgacctcgatatcgacgtgcgcatcatctccgccacccaccgc
aacctgcccaaggcgatggagctaggggagtttcgcgaggatctgttctatcgcctcaac
gtggtctccctgcgcctgccggcgctgaaccagcgcccggaggatattccgctgctggcg
gcccacctgctgcgtcaggccgccgagcgccataagccgctggtgcgcagcttctccagc
ggcgcgatgaaggcgctgatgagcgccagctggccgggcaacgtgcgtcagctggtcaat
gtcatcgagcagtgcgtggcgctgacgacggcgccggtgatcggcgaggcgctggtggag
caggcgctacagggcgaaaatacggcgctgccgacctttgtcgaggcgcgccaccacttt
gagctgcactacctgcgtaagctgctgcagatcaccaaaggaaacgtgacccatgcggcg
cgcatggccgggcgcaaccgcaccgagttttataagctgctgtcgcgtcatgagctagat
cctaatgatttcaaagagtaa

DBGET integrated database retrieval system