KEGG   Edwardsiella piscicida C07-087: ETAC_03770Help
Entry
ETAC_03770        CDS       T02509                                 

Definition
(GenBank) nitrogen regulatory protein P-II 1
  KO
K04751  nitrogen regulatory protein P-II 1
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_03770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P-II Nit_Regul_Hom DUF3240
Motif
Other DBs
NCBI-ProteinID: AGH72885
Position
871366..871704
Genome map
AA seq 112 aa AA seqDB search
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVK
LEIVVADDIVDTCVETIMQTAQTGKIGDGKIFVYDVARVVRIRTGEQDEEAI
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgatgcgattattaagccgttcaagctggatgacgtgcgtgaagcgctg
gccgaagtcggcattaccgggatgacggtaaccgaagtcaaagggtttggccgccagaag
ggacacaccgagctgtaccgcggcgcagagtatatggtggatttcctgcccaaggtgaag
ctggagatcgtggtggccgacgatatcgtcgatacctgcgttgagaccatcatgcagacg
gcgcagaccggcaagatcggcgacggcaagatttttgtctacgacgtggcgcgggtcgtt
cgtatccgcaccggcgagcaggacgaagaggctatctga

DBGET integrated database retrieval system