KEGG   Edwardsiella piscicida C07-087: ETAC_03855Help
Entry
ETAC_03855        CDS       T02509                                 

Gene name
proA
Definition
(GenBank) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00330  Arginine and proline metabolism
etc00332  Carbapenem biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ETAC_03855 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ETAC_03855 (proA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     ETAC_03855 (proA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGH72902
Position
891105..892358
Genome map
AA seq 417 aa AA seqDB search
MLEEMGKAAKRASYQLALLSSAQKNRALALIADCLQQDSAAILQANAEDVAQARADGLSD
AMLDRLLLTESRLAAIADDVRQVCSLHDPVGDIIDGRQLDSGLTLQRRRVPLGVIGVIYE
ARPNVTVDVASLCLKTGNAVILRGGKETWRTNRATVAAIRRALEQACLPQDAVQVIESPD
RALVSELLRLDRYVDMLIPRGGAGLHRLCREQATIPVITGGIGVCHIYVDRGMEIDAALT
IITNAKTQRPSTCNTVETLLVNAAIAPAFMPALSAQMKRAGVTLHACPRALPLLQDGPAT
TVALDLAALDDEWLSLDLSVVLVDDLDGAIDHIRLHGTQHSDAILTRDMRAAERFVNSVD
SAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIGYGDDLVRA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagagatgggaaaggccgccaaacgggcctcatatcagctggcgctgctgagc
agcgcgcagaaaaaccgggcgctggcgctgatcgccgactgcctgcagcaggacagcgcg
gccattttacaggccaacgcagaagacgtcgcccaggcgcgcgcggatggcctgagcgac
gcgatgctggatcgcctgctgctgaccgaatcccgcctggcggcgatcgccgacgacgtc
cgtcaggtatgcagcctgcacgatccggtcggcgatatcatcgatggccgccagctggac
agcggcctgacgctgcagcgccgccgcgttcccctgggggtgatcggggttatctatgaa
gcgcgccccaacgtcacggtggatgtcgcctcgctgtgcctgaagaccggtaacgcggtg
atcctgcgcggtggtaaagagacctggcgcaccaaccgggcgacggtggcggcgatccgc
cgggcgctggagcaggcctgcctgccgcaggacgcggtgcaggtgatcgagagcccggat
cgggcgctggtcagcgagctgctgcgcctggatcgctatgtcgacatgctgattccgcgc
ggcggcgccgggctgcaccgcctgtgccgcgagcaggcgacgatcccggtgatcaccggc
ggcatcggcgtttgccatatctatgtcgatcgcggcatggagatcgacgcggcgctgacg
attatcaccaacgccaagacccagcgccccagcacctgcaatacggtagagacgctgttg
gtcaacgccgccatcgcccccgcctttatgccggcgctcagcgcgcagatgaagcgcgcc
ggcgtgaccctgcacgcctgtccgcgcgcgctgccgctgctgcaggacggcccggcgacg
acggttgcgctggatctggccgcgctggacgatgagtggctatcgctggatctcagcgtg
gtgctggtggacgaccttgatggcgccatcgatcatattcgtctccacggcacccagcac
tcggacgccatcctgacccgcgatatgcgcgcggccgaacgctttgtgaatagcgtggat
tcggcggcggtgtacgtcaacgctagcacccgcttcaccgacggcggccagtttggcctg
ggggcagaggtcgcggtgagcacccagaagctgcatgcgcgcggcccgatggggctggag
gcgctgaccacctataagtggatcggctacggcgacgatctggtgcgcgcctga

DBGET integrated database retrieval system