KEGG   Edwardsiella piscicida C07-087: ETAC_03960Help
Entry
ETAC_03960        CDS       T02509                                 

Gene name
fabG
Definition
(GenBank) 3-ketoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00780  Biotin metabolism
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
etc01212  Fatty acid metabolism
Module
etc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_03960 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAC_03960 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETAC_03960 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_03960 (fabG)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     ETAC_03960 (fabG)
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_03960 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase LDcluster4 NAD_binding_10 Eno-Rase_NADH_b ISP3_C
Motif
Other DBs
NCBI-ProteinID: AGH72923
Position
complement(921070..921801)
Genome map
AA seq 243 aa AA seqDB search
MSRSVLVTGASKGIGRAIARQLAADGFTVGVHYHRDEAGAQETLAAIQQAGGRGRVLSFD
VGQREQCREVLEQEIAQHGAWYGVVSNAGITRDGAFPALSEDDWDSVIHTNLDSFYNVIH
PCIMPMIGLRQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNC
IAPGLIETGMIAMEETALKEAMAMIPMKRMGQADEVAGLARYLMSDIAGYVTRQVISING
GML
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctcagtactggtcaccggggccagtaaaggaattggacgtgcgattgcccgt
cagctcgccgccgacggctttaccgtgggcgttcactaccaccgcgacgaagcgggcgca
caagagaccctggccgccattcagcaggcgggcggccgcgggcgcgtgctcagctttgac
gtcggccagcgcgagcagtgtcgcgaggtgctggagcaggagatagcccagcacggcgca
tggtacggcgtggtcagcaacgcgggcataacccgcgacggcgcgtttccggccctaagt
gaagacgactgggacagcgtgatccataccaacctcgacagcttttacaacgtcattcac
ccgtgcattatgccgatgatcggcctgcgtcagggcgggcgtatcattaccctgtcgtcg
gtttccggcgtgatgggcaaccgcggccaggtgaactacagcgcggcgaaagcggggatc
atcggcgccaccaaagcgctggcgattgagctcgccaagcgcaaaatcaccgtcaactgt
attgcgcccgggctgattgagaccgggatgatcgcgatggaagagaccgcgctgaaagag
gcgatggcgatgatcccgatgaaacgcatgggccaggccgacgaagtggccgggcttgcc
cgctatttaatgtctgacattgcgggctacgtgacccgacaggtcatttccatcaacgga
gggatgctatga

KEGG   Edwardsiella piscicida C07-087: ETAC_09970Help
Entry
ETAC_09970        CDS       T02509                                 

Gene name
fabG
Definition
(GenBank) 3-ketoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00780  Biotin metabolism
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
etc01212  Fatty acid metabolism
Module
etc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_09970 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAC_09970 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETAC_09970 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_09970 (fabG)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     ETAC_09970 (fabG)
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_09970 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase DFP ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AGH74115
Position
complement(2263272..2264006)
Genome map
AA seq 244 aa AA seqDB search
MSLEGKIALVTGASRGIGRAIAETLVARGARVIGTATSDKGAEAISAYLGDNGMGMALNV
TDSASIDSMLERVRAEFGEIDILVNNAGITRDNLLMRMKDDEWQDILDTNLTSVFRLSKA
VMRAMMKKRCGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA
PGFIETDMTRALSDEQRSGILAAVPAGRLGDAKEIAYAVAFLASDEAAYITGETLHVNGG
MYMI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagaaggtaaaattgcactggtaaccggcgcaagccgtggcatcggccgcgcc
atcgccgagacgctggtcgcccgcggcgcccgcgtcatcggtacggccaccagcgacaag
ggcgcagaggcgatcagcgcttatctgggcgataacggtatgggaatggcgctgaacgtg
accgactctgcctctatcgacagcatgctggagcgcgtgcgcgcggagtttggcgagatc
gatattctggtcaataacgccgggatcacccgcgacaatctgctgatgcggatgaaggat
gatgagtggcaggatatcctggacaccaacctgacgtcggtgttccgcctgtcaaaagcc
gttatgcgcgctatgatgaagaagcgctgcgggcgtattattaccatcggctccgtggta
ggcaccatggggaacgctgggcaggcgaactacgccgcggctaaagcgggccttatcggc
ttcagcaagtcgctggcgcgtgaagtcgcctcccgcggcatcaccgttaacgtggtggcg
ccgggatttatcgagaccgatatgacgcgtgcgctctccgatgagcagcgcagcggcatt
ttggccgcggtgccggccggtcgtctgggtgatgctaaagagatcgcctacgccgttgcc
tttttggcctcggatgaggcggcctacatcaccggcgagacgctacatgtcaacggcggc
atgtacatgatctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_11395Help
Entry
ETAC_11395        CDS       T02509                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00780  Biotin metabolism
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
etc01212  Fatty acid metabolism
Module
etc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_11395
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAC_11395
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETAC_11395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_11395
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     ETAC_11395
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_11395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF3560
Motif
Other DBs
NCBI-ProteinID: AGH74400
Position
2586049..2586735
Genome map
AA seq 228 aa AA seqDB search
MSPTLLRDKVALVTGGAHGTGAAIVTALADAGARVALTYHHSEGEARLLTAQIRQRGGEA
IALRTDARSPETYARAVTRTLELWGQIDILVNQAAVTICKPFDEIELREFEQAMAINVQA
VFLTSQLTARRMPSGGRIIHISGAHQPPGHGGALCAMSRAALSALTRSMAQDLAPQGITV
NHLVPDPLPAPNRDAQSTAQAIAELALWLASPAAGAITGSQLTMAGEA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaaccctcttacgcgataaagtggcgctggtcaccggcggcgcgcacggcacc
ggtgccgccatcgtaaccgccctggccgacgccggcgcccgcgtggcactgacctaccac
cattcggaaggcgaggcgcggctgctgaccgcccaaattcgccagcggggcggcgaagcc
atcgccctgcgcaccgacgcgcgcagcccggaaacctacgcccgcgccgtcacccgcacg
ctggagctgtggggacagatcgatatcctggtcaatcaggccgccgtcaccatctgcaaa
ccatttgatgaaattgagctacgagagtttgagcaggccatggcgatcaatgtgcaggcg
gtcttcctgaccagccagctgaccgctcggcgcatgccctcgggggggagaatcatccat
atcagcggggcgcatcagcccccgggccacggcggcgcgctctgtgccatgagccgcgcg
gcgctgagcgcgctgacgcgcagcatggcgcaggacctggcgccgcagggcattacggtc
aaccacctggtgcccgatccgcttccggcgccgaaccgggacgcacagagcacggcacag
gcgatcgccgagctggcgctgtggctggcctcaccggcggcgggcgccatcaccggcagc
cagctcacgatggcgggagaggcttag

DBGET integrated database retrieval system