KEGG   Edwardsiella piscicida C07-087: ETAC_04250Help
Entry
ETAC_04250        CDS       T02509                                 

Definition
(GenBank) two component system sensor kinase SsrA
  KO
K14978  two-component system, LuxR family, secretion system sensor histidine kinase SsrA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00663  SsrA-SsrB two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_04250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_04250
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_04250
Protein kinases [BR:etc01001]
 Histidine kinases
  LuxR family [OT]
   ETAC_04250
Two-component system [BR:etc02022]
 LuxR family
  SsrA-SsrB [MD:M00663]
   ETAC_04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA Hpt HATPase_c_2 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AGH72981
Position
969865..972600
Genome map
AA seq 911 aa AA seqDB search
MSRHIWRTSLSFRLALILSGFIALFWLLSTGVTLLLNFEQTKSSLQRRLTATVAETVYEL
SSELLDVSRDVDTLMRCWHRLDDGVASGAYYLTARYIHDMTAPPDPAARISRAKAFVEAY
GSGGLGNLVDTFVLLDGGVVLSSAGGQPTDTPLHIEQIRALRDQAVGNHIIWSKPYRSVG
GNWRVIAAKRDLLTGALVGMTVNLHPSFSAVEKTPDGETIVWLDREGQPIIPLSAALSQS
LPTCQREMESNFDEVFSICREVAPVGWKLLLFTPSRQITDAAFAALHRYLPVALLLLVAL
VGLLYLVLQRTLGRTLAGIMQRLTPNVAVADLPPLVVAGEDELGRIAQVYNRLLSAVKAQ
YAQLEARVAERTVELERARRQAERASANKSEHLNSISHEIRTPLNGIIGALTLLENGENT
PEQRDLLDTGLKCSRHLLEIINNLLDFSRIESGQMVVNPEYLDPLPLIDQAMLTVQVPAL
EKGLTLHCLLAPSFPQTLYTDGLRLRQILINLLGNAVKFTPHGEVVLHGWSEQDRLCFRV
QDTGPGIDDARINDIFTAFHQVDCHIAGSGLGLPIARSLSRLLGGELSCEKSAIGARFRL
ALPLEANGSVPIVPPEDKGSIVAPLSLHPQLSAWGYHPLAGDNPDLDAPELSYLPGRLRQ
HLDGETQTTGAREQMPVSPWSLQVLVVDDVDTNQDIVGRMLRQQGHKVYTASSGSEALVL
GRGHVFDLVLMDMRMPGLSGDETLHLWRDSVNGMLDPDCPIIALTANAQPGERKRLQDAG
FNEYLTKPVTPAMLSRALEYTADIQLTRGIELSPNRAGEIPLLGQDPALRRRLQEDVLHY
LAQLTQAVAQQDAPAVRQALHTLKGLAGQGGLTLVHEAAARWEQALEGGMPMPDKALESL
SRLVHSEFEAD
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcatatctggcgcacctccctctcgttccgcctggcgctgatcctcagtgga
tttattgccctgttctggctgctgagtaccggcgtgacgctgctgctgaactttgagcag
accaagtcatcgctgcagcgccgtttgacggcgaccgtggccgaaacggtctatgagctg
agctctgagctgctggatgtcagccgtgacgtggatacgctgatgcgctgttggcaccgc
ctggacgacggcgtcgcctctggcgcctactacctgacggcgcgctacattcacgatatg
accgcgccgccggatccggcagcgcgcatcagccgcgcgaaggcctttgtcgaagcctac
ggcagcggcggcctgggcaatctggtggataccttcgtcctgctggacggcggcgtggtg
ctgtccagcgccggcggtcagccgaccgacaccccgctgcacattgaacagatccgggcg
ctgcgcgatcaggccgtcggcaatcacatcatctggagtaagccttatcgcagcgtcggg
ggaaactggcgagtgattgcggcgaagcgggatttgctcaccggtgcgctggtcggcatg
acggtcaacctgcatccctcctttagcgccgtagagaaaaccccggatggtgaaacgatc
gtttggctcgatcgggaggggcagccgatcattccgctgtccgccgcgctgagtcagagc
ctgccgacgtgccagcgcgaaatggagagtaattttgacgaggtattctccatctgccgc
gaggtcgccccggtcggctggaagctgctgctgttcacgccgagccgccagattacggac
gcggcgttcgccgcattgcaccgctatctgccggtggcgctgctgctgctggtcgcgctg
gtggggctcttgtacctggtgctgcagcgcacgctggggcgtacgctggccggcattatg
cagcgcctgacgcccaacgtggcggtggccgatctgccgcccctggtggtggcgggagag
gatgagctggggcgcattgcgcaggtctataatcgcctgctgtcggcggtcaaggcgcag
tatgcgcagctggaggcgcgggtcgccgaacgaacggtagagctggagcgtgcgcggcgc
caggccgagcgcgccagcgccaataagagcgagcacctgaacagcatcagccatgaaatt
cgcaccccgttgaatgggattatcggtgcgctgacgctgctggagaacggtgagaatacg
ccggagcagcgtgatttgctggataccgggcttaagtgttcgcgccatctgctggagatc
atcaataacctgctggacttctcgcgcattgagtcgggacagatggtggtgaacccggag
tacctcgatccgctaccgctgatcgatcaggcgatgctgacggtgcaggtgccggcgctg
gagaagggattgaccctgcactgcctgctggcgccgtcgtttccgcagacgctgtatacc
gacgggctgcgcctgcgccagatcttgatcaacctgctgggcaacgcggtcaagtttacc
ccccatggcgaggtggtgctgcacggctggagcgagcaggatcgactctgtttccgggtg
caggataccggcccgggcatcgatgacgcgcggatcaacgatatttttaccgcatttcat
caggtcgattgccacatcgccggcagcggcctggggctgccgatcgcccgcagcctgtcg
cgcctgctggggggcgagctctcctgcgagaaaagcgcgatcggcgcccgtttccgcctg
gcgctgccgctggaggcgaacgggagtgtccccatcgtgccgccggaggataagggcagc
attgtcgcgccgctcagcctgcacccacagctgtcggcctggggataccaccccctggcg
ggcgacaatcccgatctggacgcgccggagctgagctacctgcccggccgcctgcggcag
catttggatggcgaaacgcagacgaccggcgcgcgagagcagatgccggtatcgccctgg
tcgctgcaggtactggtggtggacgatgtcgataccaatcaggatatcgtcgggcgcatg
ctgcgccagcaggggcacaaagtgtataccgcctccagcggctctgaagcgctggtgctg
gggcgcgggcacgtgtttgacttagtcctgatggatatgcgtatgccggggctctccggc
gacgaaacgctgcatctgtggcgggatagcgtgaatggaatgctcgaccccgactgcccg
atcatcgcgctgacggccaatgcgcagcccggcgaacgcaagcggctgcaggacgctggt
tttaatgagtatctcaccaagccggtgacccccgcgatgctctccagagccctggagtac
acggccgatatccagttaacccgggggatcgagctgtcgcctaaccgcgcgggcgagata
ccgctgctcggacaggatcccgcgctgcggcggcgtctgcaggaggatgtcttgcactat
ctggcgcagctgacgcaggcggtcgcgcagcaggatgcccccgcggtgcggcaggcgctg
catacgctaaaagggctggccgggcagggcggtctgacgctggtgcatgaggcggcggcg
cgttgggagcaggcgctggagggcgggatgccgatgccagacaaggcgctggaaagccta
tcccgcctggtgcacagtgaattcgaggcggattaa

DBGET integrated database retrieval system