KEGG   Edwardsiella piscicida C07-087: ETAC_04255Help
Entry
ETAC_04255        CDS       T02509                                 

Definition
(GenBank) two component system sensor kinase SsrB
  KO
K14979  two-component system, LuxR family, secretion system response regulator SsrB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00663  SsrA-SsrB two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_04255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_04255
Two-component system [BR:etc02022]
 LuxR family
  SsrA-SsrB [MD:M00663]
   ETAC_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_38 HTH_29 HTH_7 HTH_28 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: AGH72982
Position
complement(972597..973241)
Genome map
AA seq 214 aa AA seqDB search
MTISILPLNILIVEDHALLADGIRNLLDSQPRYRVVGAVSNGLAVYEACQRLSPDLVLLD
LGLPGMDGVDVIRQLRRRWSDMRIVVVTASSEARRGSEALAAGALAYVLKQSPQQTLLAA
MQHASLGKTFVDPALRLDSLVASSDMAQEPPLTLRERQILKLVAEGKRNRDIAELLSISL
KTVETHRLNLMRKLDAHNAAELSNWARRLGVLEF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgactatttctattttgcctctgaacattctgatcgttgaagatcatgccttgctagcc
gatggcatccgtaatctcttggacagccagccccgctaccgggtcgtgggcgccgtctcg
aatgggctggccgtttatgaggcctgccagcgtctctcgcccgatctggtcttactcgat
ctgggtctgccgggcatggacggcgttgacgtgatccgtcagctgcggcgtcgctggagc
gatatgcgtatcgtcgtcgtcaccgcctcctctgaggcacggcgcggcagcgaagccctc
gccgccggcgcgctcgcctacgtcctgaagcaaagcccgcagcaaaccctgctggcggcc
atgcagcatgcctcgctggggaaaacctttgtcgatcccgccctccggctggactccctg
gtagcctcgtccgatatggctcaggagccgccgctgaccctgcgcgagcggcaaattctc
aagctggtcgccgagggcaagcgcaaccgggatatcgcggagctgctgtccatcagcctg
aaaaccgtggagacccaccggctcaacctgatgcgcaagctggatgcccacaacgcggcg
gagctgagcaactgggcccgccgcctgggggttctggagttttaa

DBGET integrated database retrieval system