KEGG   Edwardsiella piscicida C07-087: ETAC_04325Help
Entry
ETAC_04325        CDS       T02509                                 

Definition
(GenBank) inner membrane component of binding-protein-dependent transport system
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04325
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH72996
Position
complement(995155..996048)
Genome map
AA seq 297 aa AA seqDB search
MMNTHVSPARRAGLQRQVYGYLLLLPALVPLVLFTHYPALAALRDSLLSAAPGGGATLEH
YRTLWQDDTFIQSLYNNLRYALLTIPLAVGLALAMALAVNRRARGSALIRTAFFLPSLLP
MVAIANLWLFFYTPQLGLLNRALALLGCAPLNWLGDPDSALYCLMAVSVWREAGFFMIFY
LAALQQIDPRLSEAAAIEGASRLTFFRRVQWPLLMPTTLFVLINASMNAFRLADQVIAMT
NGGPDNSTSLLLFYIYRTAFSYWDLPYAAAMTVVLLAILATLTLMKFTLLDRRAWYQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatacccacgtttcgccggcccgccgcgctggactgcagcgccaggtatacggc
tatcttctgctgttgccggcgctggtgccgctggtgctgtttacccactaccccgcgctg
gctgcgctgcgcgatagcctgctcagcgccgcccccggcggcggcgccacgctagagcac
tatcgcaccctgtggcaggacgatacctttatacagtcgctgtacaacaacctgcgctac
gccctgctgaccattccgctggcggtgggactggcgctggccatggcgctggcggtcaat
cgccgcgcccgcggcagcgcgctcatccgcacggccttttttctgccgtcgctgctgccg
atggtcgctatcgccaacctgtggctgtttttctatacgccgcagctggggctgctcaac
cgcgcgctggcgctgctgggctgcgccccgctgaactggctgggcgatcccgatagcgcc
ctgtactgcctgatggcggtttcggtatggcgcgaagcgggcttctttatgatcttctat
ctggcggcgctgcagcagatcgatccgcgcctgagcgaagcggccgccatcgaaggcgcc
tcgcggctgaccttctttcggcgggtgcagtggcccctgctgatgcccaccaccctattt
gtgctgatcaacgcctccatgaatgcctttcgcctagcggatcaggtgatcgccatgacc
aacggcgggccggacaatagcaccagcctactgctgttctatatctaccgcaccgcgttc
agctattgggatctgccctatgcggccgcgatgaccgtcgtcctgctggcgatcctcgcc
acgctgacgctgatgaaattcaccctgctggacaggagagcctggtaccaatga

KEGG   Edwardsiella piscicida C07-087: ETAC_15840Help
Entry
ETAC_15840        CDS       T02509                                 

Definition
(GenBank) glycerol-3-phosphate transporter permease
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_15840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15840
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 CPP1-like
Motif
Other DBs
NCBI-ProteinID: AGH75289
Position
complement(3579139..3580023)
Genome map
AA seq 294 aa AA seqDB search
MNSPIPVYGRSWLPYALMAPQLAITAIFFLWPAGEALWYSLQQVDPFGLSSRFVGLANFV
QLLDDPYYLASLRTTLWFSALVTVSGLVISLFFAALVNQVLRGRRIYQTLFILPYAVAPT
IAAVLWMFLFSPGMGLISHALASIGYDWNHARYSGQAMFLVVLASVWKQVSYNFLFFLAA
LQSVPRSLIEAAAIDGAGPLRRFWHIVLPLIAPVSFFLLVVNLVYAFFDTFPVIDAATGG
GPGQSTTTLIYKIYREGFAGLDLSSSAAQSVVLMTMVIALTLIQFRYVERKVRY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaactccccgatccccgtttatggccgcagctggctgccctatgcgttaatggcgccc
cagctggcgatcaccgcgatcttttttctgtggcccgccggtgaggcgctgtggtactcc
ctgcagcaggtggacccctttggtctgtccagccgctttgttgggctggcgaactttgtc
cagctgctggatgacccctactacctggcgtcgctgcgcaccaccctgtggtttagcgcg
ctggtgaccgtcagcggcctggttatttcgctgttttttgccgcactggtgaatcaggtc
ctgcgcggccgccgcatttaccagaccctgtttatcctgccctacgccgtcgccccgacc
attgcggcggtgctgtggatgtttttgttcagccctggcatggggcttatcagccatgcg
ttggcgagcatcggctatgactggaaccacgcccgctacagcggacaggcgatgtttctg
gtggtgctggcctcagtatggaagcaggtgagttataactttctgttttttctggctgca
ttacagtcggtgccgcgctcgctgatcgaggcggcggccatcgacggcgccgggccgctg
cggcgcttctggcatatcgttctgccgctgatcgccccggtgagctttttcctgctggtg
gtcaatctggtctacgcctttttcgatacctttcccgtcatcgatgctgccaccggcggc
gggccgggacaatccaccaccaccctgatttataagatctaccgcgaaggattcgccggg
ctggatttgtccagctccgcggcgcagtcggtggtgctgatgacgatggtgatcgcgctg
accctgatccagtttcgctatgttgagcgtaaggtgcgctactga

DBGET integrated database retrieval system