KEGG   Edwardsiella piscicida C07-087: ETAC_04330Help
Entry
ETAC_04330        CDS       T02509                                 

Definition
(GenBank) extracellular solute-binding protein
  KO
K05813  sn-glycerol 3-phosphate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04330
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGH72997
Position
complement(996061..997335)
Genome map
AA seq 424 aa AA seqDB search
MRRSLPRYAAASLLALTACVASAAPVTLQMYYPIAVGGKVSQTVDALVADFEQQHPDIRI
QPVYTGDYATTVTKALTAFRGGNPPQLAVIGDIEVYSLKEAGAIAPISDLVDDAAGQAWL
DSFYPAFIRRIDGKVYGIPFQRSTVVLYWNKQAFAQAGLDPEHPPQSWREVESFGRRLTL
REGNQVRQWGIEIPSTPIGYWTFQAIAATNGGTLDNRRGTAVTFDTAANREALSWLHDLA
RQHAISPPGAIHWGSTPQDFIDGKTAMMVTTTGNLATVRDSAKFPFGVAMLPANTGRGSP
TGGGNLYLFSQASAAQRQAALRFIRWLSAPAQAARWSIATGYVATSPAAWQTEAMQRYVQ
QFPQATVARDQLQYSQPELSTYRSVQVQELLNRAVEAAVTGGKSPQQALADAQRQADRLL
QRYP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgatctctgccccggtacgccgcggccagcctactggccctgaccgcctgcgta
gccagcgcggccccggtgaccctccagatgtactaccccatcgccgtcggcggcaaggtt
agccagaccgtcgacgccctggtcgccgactttgaacagcagcatcccgacatccgcatt
cagccggtctacaccggcgactatgccaccacggtcaccaaggcactgaccgcctttcgc
ggcggcaacccgccccagctggcggtgatcggcgatatcgaggtctactcgctgaaggag
gccggcgccatcgcccccatcagcgatctggtcgatgacgcggcgggacaggcctggctg
gacagcttctatccggcctttattcgccgcatcgacggcaaggtctacggcatcccgttt
caacgctctaccgtcgtgctgtattggaataaacaggcgttcgcccaggcggggctggat
cccgagcacccgccccagagctggcgagaggtggagtcgtttggccgccgcctgaccctg
cgcgaaggtaatcaggtgcgccagtggggaatagagatcccgtcaacgccgataggctac
tggaccttccaggctatcgccgccaccaacggggggacgctggacaaccgccgcggcacc
gccgtcacctttgataccgccgccaaccgagaggcgctcagctggctgcacgatctggcg
cgacagcacgccatctcaccgccgggcgccattcactggggctcgacgccgcaggacttt
atcgatggcaagacggcgatgatggtgaccaccaccggcaacctggcgacggtgcgcgat
agcgccaaattccccttcggcgtcgccatgctgccggccaataccgggcgcggcagcccc
accggcggcggcaacctgtacctgttcagccaggcaagcgcggcgcagcgccaggcggcc
ctgcgctttatccgctggctctccgccccggcgcaggcggcgcgctggagcatcgccacc
ggctatgtcgccacctcgccggccgcctggcagaccgaggccatgcagcgctatgtacag
cagttcccccaggccacggtcgcccgcgatcagctccaatactcccagccggagctctcc
acctaccgcagcgtacaggtgcaggagttgctcaaccgggccgtcgaagccgccgtcacc
ggcgggaaaagcccccagcaggcccttgctgacgcccagcgccaggccgatcgcctgctg
cagcgctacccgtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_15845Help
Entry
ETAC_15845        CDS       T02509                                 

Definition
(GenBank) glycerol-3-phosphate transporter periplasmic binding protein
  KO
K05813  sn-glycerol 3-phosphate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_15845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15845
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_15845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 F_bP_aldolase Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: AGH75290
Position
complement(3580090..3581409)
Genome map
AA seq 439 aa AA seqDB search
MVNKVTLTLASLAMTLTLSSPGWAVTEIPFWHSMDAELGKEVDSLAARFNQSQRDYRVVP
IYKGDYEQSMAAGIAAFRSGKAPAILQVYEVGTATMMQARQAVKPVYQVFQEAGIAFDEG
QFVPTVAGYYADGDNGHLLSQPFNSSTPVLYYNKEAFRKAGLDPQAPPQTWQQLAQYAAT
LRQSGMRCGYATGWQGWVQLENFSAWNGLPFASENNGFGGPSARLTFNQPTQVAHIQRLA
DMLKQGDFSYFGRKDEPTAKFYNGDCAMVTASSGSLANIRQYAKFDYGVAFMPYDERIGS
APQNAIIGGASLWVMNGKSPQTYRGVAEFLRFLTRPENAAEWHQKTGYLPVTTAAYELTR
QQGFYDRNPGADTATRQMLNKAPLPFTKGVRLGNMPQIRTVVDEELEGVWTGKQSAQQAL
DNAVMRGDRLLVRFEQSTR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggttaacaaggtaacactgacgctggcctcgctggccatgaccctgacgctgagcagc
ccgggatgggcggtcaccgagatcccgttctggcattcaatggatgccgagctgggcaaa
gaggtggatagcctggcggcgcgctttaaccagtcacagcgtgactacagggtggtgccg
atctacaagggcgactacgagcagagcatggcggccggcatcgcggccttccgcagcggt
aaggcaccggcgatcctgcaggtgtatgaggtcggaacggcgacgatgatgcaggcgcgt
caggcggtgaagccggtttaccaggtttttcaggaggcagggatcgcctttgatgaaggg
cagtttgtgccgacggtcgccgggtactatgccgatggcgacaatgggcatctgctgtct
cagccgttcaacagctcgacgccggtgctctactacaataaagaggccttcagaaaggcg
gggctggatccgcaggcgccgccgcagacctggcaacagctggcgcagtacgccgccacg
ctgcgccagagcggcatgcgctgtggctatgccaccggttggcagggctgggtgcagttg
gaaaacttcagcgcctggaacggcctgccctttgcttcggagaataacggcttcggcggt
ccgtccgcgcgcctgacctttaaccagccgacgcaggtggcccatattcagcgcctggca
gatatgctgaagcagggagattttagctacttcgggcgtaaggatgagccgaccgccaaa
ttctataacggtgactgcgcgatggtcaccgcctcttccggttcgctggccaatattcgc
cagtacgccaagtttgactatggcgtcgcctttatgccctacgatgagcgtatcggcagc
gcgccgcagaatgccattatcggtggcgccagcctgtgggtcatgaacggtaagagcccg
cagacttaccgcggcgtcgccgagtttctccgctttctcacccgcccggagaatgcggcg
gagtggcatcaaaagaccggctatctgccggtgacgaccgctgcctatgagctgacgcga
cagcagggattctacgatcgcaatcccggcgccgatacggcgacgcgccagatgctgaat
aaagcgccgctgccgtttactaaaggcgtacgtctgggcaacatgccgcagatccgcacc
gtggtagacgaggagctagagggggtctggaccggcaagcagagcgcccagcaggcgctg
gataacgccgtgatgcgcggcgatcggctgctggtgcgttttgagcagagtacccgttag

DBGET integrated database retrieval system