KEGG   Edwardsiella piscicida C07-087: ETAC_04335Help
Entry
ETAC_04335        CDS       T02509                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K05816  sn-glycerol 3-phosphate transport system ATP-binding protein [EC:7.6.2.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04335
Enzymes [BR:etc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.10  ABC-type glycerol 3-phosphate transporter
     ETAC_04335
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_04335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_16 SMC_N RsgA_GTPase AAA_22 AAA_33 AAA_25 AAA_28 AAA_29 NACHT AAA_30 Rad17 AAA OB_MalK AAA_5 TsaE PduV-EutP AAA_23 AAA_18 IstB_IS21 ATPase_2 AAA_24 AAA_14 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AGH72998
Position
complement(997366..998463)
Genome map
AA seq 365 aa AA seqDB search
MSYLTLHHIHKAWGDKTALRDISFSVREGEFVALLGPSGCGKTTLLRTLAGLDQADSGTI
RLRGEPVEHLPPAQRQLSMVFQSYALFPHLSVRENLLFGLRARHEEKRHFASRLAEVSAL
LELDTLLDRLPAQLSGGQQQRVALGRAVIARRRLCLMDEPLSNLDARLRQTMRREIRTLQ
QRLGLTVLYVTHDQLEAMSMADRVILLHEGAIVQHDSPENLYHDPASSFAARFIGAPPMN
LLPLRRRSGWHCLGHQPICADDGQTALTLGLRAENLTLTALGAGKTDARISAVEYMGADT
WLQCALECGGELTVSMSGLRRVSPGSAVGLSWPRQAQYLFHRDSGARCRDAEQPFLPRVA
LHAAH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagctacctgacgctgcaccatattcataaagcctggggagataaaaccgccctacgc
gacatcagcttctccgtccgcgaaggggagtttgtcgcccttctcggcccgtcgggctgt
ggaaaaaccaccctgctgcgcaccctggccggcctggatcaggccgatagcggcaccatc
cgcctgcgcggcgagccggtggaacacctgccgccggcgcagcgtcagctgtcgatggtg
ttccaatcctacgccctgtttccccacctcagcgtccgtgaaaacctgctgttcggactg
cgggcgcgccatgaggagaaacgtcacttcgccagccgcctggccgaggtcagcgccctg
ctggagctggataccctgctcgatcgcctgcccgcgcagctctccggcgggcagcagcag
cgggtcgccctggggcgggccgtcatcgcccgccgccgactgtgtctgatggatgagccg
ctctccaatctggacgcccggctgcgccagaccatgcgccgcgagatccgtaccctgcag
cagcgcctggggctgacggtgctgtacgtcacccacgatcagctggaggccatgagcatg
gccgatcgcgtcatcctgctgcacgagggggccatcgtccagcacgacagtccggaaaac
ctctatcacgatcccgccagcagctttgccgcccgatttatcggcgcaccgccgatgaat
ctgctgcccctgcgccgccgcagcggctggcattgcctgggccaccagcccatctgcgcc
gatgatggccagacggcgctgacgctggggctgcgcgccgaaaacctgaccctgaccgcc
ctgggcgccggtaaaaccgacgcccggatcagcgccgtcgaatatatgggcgccgatacc
tggctgcagtgtgcgctggagtgcggcggcgagctcaccgtcagcatgagcgggctgcgc
cgcgtcagccccggcagcgccgtcggcctaagctggccgcgccaggcccagtatctattt
caccgtgacagcggtgcgcgctgccgcgacgctgaacagccgtttttaccccgggttgcc
cttcacgccgcccattga

KEGG   Edwardsiella piscicida C07-087: ETAC_15830Help
Entry
ETAC_15830        CDS       T02509                                 

Gene name
ugpC
Definition
(GenBank) glycerol-3-phosphate transporter ATP-binding subunit
  KO
K05816  sn-glycerol 3-phosphate transport system ATP-binding protein [EC:7.6.2.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_15830 (ugpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15830 (ugpC)
Enzymes [BR:etc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.10  ABC-type glycerol 3-phosphate transporter
     ETAC_15830 (ugpC)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    ETAC_15830 (ugpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran OB_MalK TOBE_2 AAA_21 AAA_16 RsgA_GTPase SMC_N AAA_22 Rad17 CysA_C_terminal AAA_33 AAA_23 AAA_29 ATPase_2 AAA_30 RNA_helicase AAA AAA_25 NACHT AAA_28 MMR_HSR1 T2SSE Zeta_toxin NB-ARC
Motif
Other DBs
NCBI-ProteinID: AGH75287
Position
complement(3577169..3578272)
Genome map
AA seq 367 aa AA seqDB search
MARLTLQNVSKSYDGRQTIIKGIDLEVQDGEFIVMVGPSGCGKSTLLRMVAGLEQTSGGD
IYIGDERVTQREPKDRGVAMVFQNYALYPHMTVADNMGYGLKIRGLGKQQIRRRVEEVAQ
ILELGALLDRRPGELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLELQQL
HRRLKTTSLYVTHDQVEAMTLAQRVIVLNKGVAEQIGTPTEIYHRPASRFVAGFMGAPAM
NLFDGALADDGQTFCLAQDQRIRLQRPLPALAGRSLTLGIRPEHLRCASATQGETGNGLT
IDTLELLGADNLAHGRWGGQSVTVRLPYQAVPAIGSVLQLVLPQDNLHFFEPSDGRRIAP
SAEEPSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttaacattacagaatgtcagtaaaagctatgatggacggcagacgatcatc
aaagggatcgatctggaggtgcaggatggcgagtttatcgtgatggtcggcccctccggc
tgcggtaagtccaccctgctgcgcatggtggccggtctggagcagaccagcggcggcgat
atctatatcggcgatgagcgggtgacccagcgggagcctaaagatcgcggcgtggcgatg
gtgttccagaactacgcgctgtatccccatatgacggtggcggacaacatgggctacggc
ctgaagatccgcgggctgggtaagcagcagatccgtcggcgggtcgaggaggttgcccag
atccttgagctgggcgcgctgctggatcggcgccccggcgaactgtccggcggtcagcgc
cagcgcgtcgcgatggggcgggcgattgtccgcgagccggcggttttcctgtttgatgag
ccgctctccaacctggatgccaagctgcgggtgcagatgcgcttggagctgcagcagctg
catcggcggctgaagaccaccagtctctatgtcacccacgatcaggtggaggcgatgacg
ctggcccagcgggttatcgtgctcaataagggggtcgccgagcagatcggcaccccgacc
gagatctatcatcgcccggccagccgctttgtcgccggattcatgggggctccggcgatg
aatctgtttgacggcgcgctggcggacgatgggcagaccttttgtctggcgcaggatcag
cgcatccggctgcagcggccgctgccggcgttggccggccgatcgctgacgctcgggatc
cgtcctgaacacctgcggtgcgccagcgcgacgcagggcgagacggggaacgggctgacc
atcgatacgctggagctgctgggcgccgacaacctggcgcacgggcgctggggcggccag
agcgtcaccgtgcgtttaccctatcaggcggtgccggccatcggcagcgtattgcagctg
gtgctaccgcaggataacctgcacttctttgaacctagcgacgggcggcgcatcgcgccg
tccgcagaggaaccatcatcatga

DBGET integrated database retrieval system