KEGG   Edwardsiella piscicida C07-087: ETAC_04355Help
Entry
ETAC_04355        CDS       T02509                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00550  Peptidoglycan biosynthesis
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETAC_04355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_04355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
    ETAC_04355
Enzymes [BR:etc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETAC_04355
Peptidases [BR:etc01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ETAC_04355
Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ETAC_04355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CDPS
Motif
Other DBs
NCBI-ProteinID: AGH73002
Position
1006492..1007655
Genome map
AA seq 387 aa AA seqDB search
MNTVAKIPLALLLLAGAAQAQMAFPLVPPHIDAASWVLMDAQTGQILAAGNPDARRNPAS
LTKLMTNYVVEQALDQGRIGLNDRVSIGDDAWATRNPLFKGSSLMFLKPGDRATVSDLIR
GIIIDSGNDACVALSDYVSGDQADFVRQMNADVSALHLQNTHFETVHGLDAPGQYSSARD
LALLARAIITHEQPYYHFYAEKSLSWNGVTQNNRNGLLWDQDLHVDGMKTGHTASAGFNL
VATSVDARGQRLIAVVMGADSSRGREQQAKKLLLWGERNFETVQLAASDSAVTRQQVRYG
QQQTVALGNPQNIYYTLPKGELRDVKVEYTLSHDYLKAPLAKGEVVGQVDYLYGGRKIGS
YALRTLSPVAEAGWFSRLEDYIAIKIG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacagttgccaaaatcccgctggccctcttactgcttgccggcgccgcccaggca
cagatggcctttcctctggtgccgccccatatcgatgccgcatcctgggtactgatggat
gcccagaccggccagatcctggccgccggcaacccggatgcccggcgtaacccggccagc
ctgaccaagctgatgaccaactacgtggtggaacaggcgctggatcagggacggatcggg
ctaaacgatcgcgtgtcgatcggcgacgacgcctgggcgacccgcaatccgctgtttaag
ggatcgtcgctgatgttcctcaagccgggggatcgcgcgacggtcagcgatctgatccgc
gggatcatcattgactccggcaacgacgcctgcgttgccctgtctgactatgtcagcggg
gatcaggccgattttgtccgccagatgaacgccgacgtcagcgcgctgcacctgcagaat
acccactttgaaacggtgcacggcctggatgcgcccgggcagtacagcagcgcgcgcgat
ctggcgctgctggcccgcgccatcattacccatgagcagccctactaccatttttatgcg
gaaaagagcctgagctggaacggggtgacccagaacaaccgtaacgggctgctgtgggat
caggatctgcacgtggacgggatgaagaccggccacaccgccagcgccggcttcaatctg
gtggccaccagcgttgacgcccgcggccagcgtctgatcgccgtggtgatgggggccgac
agcagccgaggacgagagcagcaggcaaagaaactgctgctgtggggcgagcgtaacttt
gagaccgtgcagctggcggccagcgatagcgcggtgacccgtcagcaggtgcgctatggt
cagcagcagaccgtggcgctgggcaacccgcagaatatttactacaccctgccgaagggt
gaactgcgcgacgtgaaggtggagtacaccctgagccatgactatctgaaggcgccgctg
gccaagggcgaggtcgtcgggcaggtggactacctgtacggcggtaggaagatcggcagc
tatgcgctgcgcacgctctccccggtcgccgaggccggctggttctcccgtctggaggac
tatatcgcgattaagatcggctga

KEGG   Edwardsiella piscicida C07-087: ETAC_10715Help
Entry
ETAC_10715        CDS       T02509                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00550  Peptidoglycan biosynthesis
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETAC_10715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_10715
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
    ETAC_10715
Enzymes [BR:etc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETAC_10715
Peptidases [BR:etc01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ETAC_10715
Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ETAC_10715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Carot_N
Motif
Other DBs
NCBI-ProteinID: AGH74264
Position
complement(2431389..2432588)
Genome map
AA seq 399 aa AA seqDB search
MKNRALTVFIRRLTLGASLSLVALPLLAADPAPPQINAKAYILLDYDSGRVLTEGNADER
LDPASLTKIMASYVIGQALKSGKIAPGDMVVVGKDAWATGNPLLRGSSLMFLKPGDRVPV
AELNRGVVIQSGNDASIALADHVAGSQDAFVNLMNQYVGAWGLKNTHFRTVHGLDSEGQY
SSARDMALISQRLIADVPDEYQLNKEKEFTFNKIRQINRNRLLWDSSLNVDGVKTGFTSG
AGHNLVASATDGPMRLISVVLGAPTDRIRFDESKKLLTWGFRFYETVTPIKVGQPFTTQK
VWYGERSEVPLGVDKSAAVTIPRGQMKDLKASYTLTQSQLEAPLKKGQAVGTIDFQLNGK
TIEQRPLVVLEDVPEAGFFGRIIDFIMLKLHSLFGGWFG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcgtgcgcttaccgtttttatccgcaggctaacgctgggtgcgagcctgtct
ttggttgccttaccgctgctagccgccgatccggcgccgccgcagatcaatgccaaggcc
tatatcctgctggactatgatagcggccgggtgctgacggaggggaacgccgacgagcgt
ctggatcccgccagcctgaccaaaatcatggcgagctatgttatcggccaggcgctgaag
agcggcaagattgcgcctggcgatatggtggtggtcggtaaggatgcctgggcgaccggg
aacccgctgctgcgcggctcctcgctgatgtttctcaagcccggcgatcgggttccggtt
gcggagctgaaccgcggggtggttattcagtccggcaatgacgccagcatcgcgctggca
gatcacgtggccggcagtcaggacgcgtttgttaatctgatgaaccagtacgttggcgcc
tgggggctgaagaatacccacttccgcaccgtacatggcctggattccgagggccagtac
agctcggcgcgggatatggcgctgatcagccagcgcctgatcgccgatgtgccggatgag
tatcagctgaataaagaaaaggagtttacctttaataagatccgtcagatcaaccgcaac
cgtctgctgtgggacagcagcctgaacgtggacggggtgaagacggggtttaccagcggc
gccgggcataacctggttgcatcggcgacggatggtccgatgcggctgatttcggtggtg
ttaggtgcgccaaccgatcggatacgcttcgacgaaagcaaaaagctgctgacctgggga
tttcgtttctatgaaaccgttactccgatcaaggtaggtcagccctttaccacccagaaa
gtgtggtacggcgagcgcagcgaggtgccgctgggcgtggacaagagcgccgcggtcacc
attccccgtgggcagatgaaggatctgaaggccagctatacgctgacgcagtcgcagctg
gaggcgccgctgaagaaggggcaggcggtgggcaccatcgattttcagcttaacggcaaa
accattgagcagcgtccgctggtggtgctagaggatgtgccggaggctggctttttcggc
cgcatcatcgactttattatgctgaagctgcacagcctgttcggcggctggttcggctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_12720Help
Entry
ETAC_12720        CDS       T02509                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase fraction A
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00550  Peptidoglycan biosynthesis
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETAC_12720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_12720
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
    ETAC_12720
Enzymes [BR:etc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETAC_12720
Peptidases [BR:etc01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ETAC_12720
Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ETAC_12720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AGH74665
Position
2869231..2870442
Genome map
AA seq 403 aa AA seqDB search
MKRKVASQTLKYAVAGGLLAVALTGAARADDVNLKTMIPGVPQIDAEAYILIDYNSGKVL
AEHNADERRNPASLTKMMTSYVIGQAMRAGKFGENDVVTVGKDAWATGNPVFQGSSLMFL
KPGDQVSVGNLIRGINLVSGNDACVAMADYVAGSQDAFVGLMNSYVKALGLQNTHFETVH
GLDASGQFSSARDMALIGQALIRDVPHEYAIYKEKEFTYNNIRQTNRNGLLWDTSMNVDG
IKTGHTASAGYNLVASATEGNMRLISAVMGGRTFKGRETESKKLLTWGFRFFETVSPLKA
GREFASEPVWFGDTDRAQLGVDKDVYLTIPRGRMKDLKASYVLNSNELDAPLAKDQVVGT
INFQLDGKTIEQRPLVVLNEVKEGGFFSRMIDHIKLLFHRWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaagttgcttcccaaacactgaaatacgctgtcgccggcggtctgctggcc
gtggcgctcaccggtgcggcccgcgccgacgacgttaacctgaagaccatgatcccaggc
gtgccgcaaatcgatgccgaagcctatattctgatcgactacaactccggcaaggtgctg
gcggagcacaacgccgacgagcgacgcaacccggcttcgctgaccaagatgatgaccagc
tatgtcatcgggcaggcgatgcgcgcgggcaagttcggtgagaacgacgtcgtcaccgtc
ggtaaagacgcctgggcgaccggaaacccggtgttccagggctcttcgctgatgttcctc
aagccgggcgatcaggtctccgtggggaacctgatccgcgggatcaacctggtctccggt
aacgatgcctgcgtcgccatggccgactatgtcgccggtagccaggacgccttcgtcggc
ctgatgaacagctacgtgaaggcgctgggtctgcagaacacccactttgagacggtacac
ggcctggacgcgtcggggcagttcagctccgcccgcgacatggcgctgatcggccaggcg
ctgatccgcgacgttccccatgagtacgccatctacaaagagaaagagttcacctataac
aacatccgccagaccaaccgtaacggtctgctgtgggataccagcatgaacgtggacggc
atcaaaaccggccataccgcctctgccggctataacctggtggcctcggcgaccgagggc
aacatgcgcctgatctccgccgtcatgggcggccgtacctttaaggggcgcgagaccgag
agcaagaagctgttgacctggggcttccgcttctttgaaaccgtctcgccgctgaaggcc
gggcgtgagttcgcctctgagccggtctggttcggtgacaccgaccgcgcccagctgggg
gtggataaagacgtctacctgaccattccgcgcggacggatgaaagatctcaaggccagc
tacgtgctgaacagcaacgaactggatgccccgctggccaaagatcaggtggtcggcacg
atcaacttccagctggacggcaagactatcgaacagcgcccgctggtggtgctgaacgaa
gtgaaagagggtggcttcttcagccggatgatcgatcatatcaagctgctgtttcatcgc
tggtttggttaa

KEGG   Edwardsiella piscicida C07-087: ETAC_15585Help
Entry
ETAC_15585        CDS       T02509                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1a
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00550  Peptidoglycan biosynthesis
etc01100  Metabolic pathways
etc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETAC_15585 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_15585 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:etc01003]
    ETAC_15585 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
    ETAC_15585 (mrcA)
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ETAC_15585 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETAC_15585 (mrcA)
Glycosyltransferases [BR:etc01003]
 Polysaccharide
  Bacterial polysaccharide
   ETAC_15585 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:etc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ETAC_15585 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AGH75238
Position
3515534..3518098
Genome map
AA seq 854 aa AA seqDB search
MKFVKYLIILAVCCILLGVTAVFGLYKYVEPQLPDVATLKDVRLQTPMQVYSADGYLIAQ
YGEKRRIPLPLTQIPPLMVKAFIATEDSRFFEHHGVDPIGIFRAASVALFTGHASQGAST
ITQQLARNFFLSPERTLMRKVKEAFLAIRIEQLLNKDEILDLYLNKIYLGYRAYGVGAAA
QVYFGKSVDQLTLSEMAMIAGLPKAPSTFNPLYSHDRAVARRNVVLGRMLDEHYITQAQY
DQARSEPLVSRYHGPEIDFSAPYLAEMVRQQMVEKYGENAYTDGFKVYTTITKHLQVAAQ
TALRDNVINYDMRHGYRGPSNVLWKVGQPAWSQQRITDTLNGLPSYGPLLPAVVMSANAD
SATVMLANGNGVSLPLATVRWARPYRSDRVQGATPRKVSDVLQPGQQIWVRQDSDKRWWL
AQVPDVNSALVSISPQDGAIKALVGGFDFNQSKFNRVTQSVRQVGSNIKPFLYTAAMDKG
LTLATILNDLPISRWDAGAGTDWRPKNSPPTYAGPIRLRQGLGESKNVVMVRAMRAMGVD
YAADYLLRFGFPAQNIVKTESLALGSANFTPLQLVRGYAVFANGGYLVDPYFITKIVDGS
DQTIYEAHPKVVCDSCNLPVIYGPTPKSAVLSDDSVENVAVSTTPGVNGSVPMPELEQVT
PGQVSQDSDQRYAPHVISTPLAFLMHDALSSNIWGEPGWMGTGWRAMRDLKRHDIGGKTG
TTNSSKDAWFSGYGPGIVTSVWIGFDDHRRDLGRTTVSGALKDQISGGEGGAKSAQPAWD
DFMKSALTGIPEQPLPPPPGIVSVVIDRATGKLATGSGNSRSEYFIEGTQPTDYATPDAG
TVIINNEGQSQELF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttaatcatcctcgcagtctgttgcattctgctgggagtcact
gcggtatttggactgtacaaatacgttgagccgcagctcccagacgttgcaacgctgaaa
gacgtgcggctacagacaccgatgcaggtgtacagcgccgacggctatctcatcgcccaa
tatggtgaaaagcgccgtattccgctgccgctcacgcagatccccccgctgatggtcaag
gcgtttatcgcgaccgaagacagccgtttcttcgaacaccacggcgttgatcctatcggc
atctttcgtgcagcctccgtcgccctgtttaccggccatgcctcacagggcgccagtacc
atcacccagcagctggccagaaactttttcctcagcccagagcgaacgctgatgcgtaaa
gtaaaggaggccttcctcgcaattcgcatcgagcagctgttgaataaagacgaaattctc
gatctctatctcaataaaatttatctgggctaccgcgcctacggcgtcggcgccgcagcg
caggtctactttggtaaatccgtcgatcagctcacgctgagtgaaatggccatgatcgcg
ggcctgcccaaagcgccgtccacctttaacccgctctactcacacgatcgcgccgtcgct
cgccgcaacgtcgtgctgggccggatgttggatgagcactacatcacccaggcacagtac
gatcaggcacgcagcgaaccgctggtctcccgctatcacgggcctgagatcgacttctcc
gccccctatctggccgaaatggtgcgccagcagatggtggagaaatacggtgaaaacgcc
tataccgacggctttaaggtctataccaccatcactaaacacctgcaggttgccgcccaa
acggcgctgcgcgataacgtgatcaactacgatatgcgccacggctaccgcggcccctcc
aacgtactgtggaaggtcggccagcctgcctggagccagcagcggatcaccgatacgctg
aacggcctaccctcctatggcccgctgctgccggccgtcgtgatgtcggccaatgccgac
agcgccacggtcatgctggccaacggcaacggcgtctcattgccgctggcgaccgtgcgc
tgggctcgtccctaccgcagcgatcgcgtgcagggcgctacgccgcggaaagtcagcgac
gtcctgcagccgggacagcagatttgggtgcgtcaggatagcgataagcgctggtggcta
gcgcaggtgccagacgtcaactccgccctggtctccatcagcccgcaggatggcgccatc
aaggcgctggtcggcggctttgactttaatcagagcaaattcaaccgcgtcacccagtcg
gtgcgccaggtcggctccaatatcaagccgttcctgtacaccgccgccatggataagggg
ctgacgctggcgaccatcctcaacgatctgcccatctcccgttgggatgctggcgccggt
accgattggcggccgaaaaactcaccgccgacctatgccggccccattcgcctgcgtcag
gggctcggtgagtcgaaaaacgtggtgatggtgcgcgccatgcgcgccatgggcgtcgat
tacgccgcagactatctgctgcgcttcggcttcccggcgcagaacatcgtgaagaccgaa
tccctggcgctgggctcagccaactttaccccgctgcagctggtgcgtggctacgccgtc
tttgccaacggcggctatctggtcgacccctacttcatcaccaagatcgtcgacggcagc
gatcagacgatctatgaagcccatccgaaggtcgtatgcgacagctgtaacctgccggtt
atctatggcccgacgccgaagtcggcggtattgagcgacgacagcgtagaaaacgtcgcc
gtctcaacgaccccgggggtgaacggcagcgtaccgatgccggagctggagcaggtcacc
ccaggtcaggtcagtcaggatagcgatcagcgctatgcgccgcacgttatcagcacgccg
ctggctttcctgatgcacgacgcgctgagcagcaacatctggggcgagccgggctggatg
ggaaccgggtggcgcgcgatgcgcgatctgaagcgccatgatatcggcgggaaaaccggg
accaccaacagctccaaagacgcttggttctccggctacggtccgggtattgtcaccagc
gtctggataggctttgacgatcatcggcgcgatctgggacgcaccaccgtgtctggagcc
ctgaaggatcagatctccggcggcgagggcggggccaagagcgcccagccggcatgggac
gacttcatgaaatcggcgctgaccggaatccccgagcagccgcttccgccgccaccgggc
attgtcagcgtcgttatcgacagggcgaccggcaagctggccaccggcagcggtaacagc
cgcagcgagtacttcattgaggggacccagccgacggactatgccacgccggacgccggc
accgtgatcatcaacaatgaggggcagagccaggagctgttctga

DBGET integrated database retrieval system