KEGG   Edwardsiella piscicida C07-087: ETAC_04385Help
Entry
ETAC_04385        CDS       T02509                                 

Definition
(GenBank) N-acetylmuramic acid 6-phosphate etherase
  KO
K07106  N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_04385
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     ETAC_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2
Motif
Other DBs
NCBI-ProteinID: AGH73008
Position
complement(1013450..1014358)
Genome map
AA seq 302 aa AA seqDB search
MSLNLDAMMTERRNPASAAIDTLSTLDILTLINAEDSKVAPAIARILPQIAQAVDAVSAA
FARQGRLIYCGAGTSGRLGILDASECPPTFGTPAEQVIGVIAGGQRAILQAVENAEDNPQ
AAQDDLQRLALSSRDVVVGIAASGRTPYVLGALRYARDVGATTVALSCNPDSPMAPLADI
LLTPIVGPEVITGSSRMKAGTAQKMILNMLSSAAMIRSGKVYGNLMVDVEATNAKLVERQ
IRIVMEAGECDRATAVAALEHSQRQCKTAIVMVLTGLSAAEAQALLDRHRGFIRPALNER
SA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaaccttgacgccatgatgaccgaacgccgtaacccggccagcgccgccatc
gataccctgtccaccctggacattctgaccctgatcaacgccgaggacagtaaggtcgcc
ccggccattgcgcgtatcctgccgcagatagcccaggcggtggatgccgtcagcgccgcc
tttgcgcgtcagggacggctgatctactgcggcgccggcacctcggggcgcctggggatc
ctggacgccagcgagtgtccccccacctttggcaccccggcggagcaggtgatcggcgtg
atcgccggcggacagcgggctattttgcaggcggtagagaatgcggaggacaacccgcag
gcggcgcaggacgatctgcagcgcctggcgctgtcgtcccgcgacgtggtggtcggtatc
gccgccagcggacgcaccccctatgtcctgggcgccctgcgctacgcccgcgacgtcggg
gcgaccaccgttgcgctgagctgtaacccggacagcccgatggcgccgctggccgatatc
ctcctgacgccgatcgtcggccccgaggtgattaccggatcctcgcggatgaaggcggga
acggcgcagaaaatgatcctgaatatgctgagcagcgcggcgatgatccgcagcgggaag
gtctatggcaacctgatggtggacgtagaggcgaccaacgccaagctggtcgagcgccaa
atccgtattgtgatggaggccggagagtgcgatcgcgccaccgccgttgcggcgctggag
cacagccagcggcagtgtaaaaccgccatcgtaatggtgctgaccggcctgtcggccgcc
gaggcgcaggcgctgctcgaccgacaccggggctttatccgcccggcgctgaatgagcgc
tcggcctga

DBGET integrated database retrieval system