KEGG   Edwardsiella piscicida C07-087: ETAC_04410Help
Entry
ETAC_04410        CDS       T02509                                 

Definition
(GenBank) molybdenum ABC transporter substrate-binding protein
  KO
K02020  molybdate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04410
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_8 SBP_bac_3 Phosphonate-bd SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AGH73013
Position
1018582..1019298
Genome map
AA seq 238 aa AA seqDB search
MLWGWGALAAAAELHLYAGAGLREPVEAVVSAFEKQSGHRVTVEYGGSGQLLTRINLTHA
GDLFLPGSADYVERLRAQGRVSFSAPLVLHTPVMVVRRDTGAQVETLAQLAQSPLRIGMG
DPHAIALGRSGDALLEASGYGQALRSRVVVQATTIKQLLLYVLNGDVDAAVIGRADAMRH
RDRLRLLPTPPGVPQEVATIAVLQGSDQAAAARALAEYFASPQGIRAFTDRGYLPLAK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgctgtggggctggggggcactggctgccgcggcagagctgcatctgtacgccggcgcc
ggcctgcgggagccggtagaggcggtggtcagcgcctttgaaaagcagagtggccaccgg
gtgacggtggagtacggcggctcgggacagctgctgacgcgaattaacctgacgcacgcc
ggcgatctgtttctgcccggttcggccgactatgtcgagcgcctgcgcgctcaggggcgg
gtgagtttctctgcgccgctggtgctgcatacgccggtgatggtggtgcgacgggatacc
ggcgcccaggtggagacgctggcgcagctggcgcaaagcccgctgaggatcgggatgggc
gatccgcacgccatcgcgctgggacgcagcggcgatgcgctgctggaggccagcggatac
ggtcaggcgctgcgcagcagggtggtggttcaggcgacgacgattaaacagctgctgctg
tatgtgctcaacggcgacgtggatgccgcggtgatcggccgggcggatgccatgcgccac
cgcgatcggctgcgcctactgccgacgccgcccggggtgccgcaggaggtggcgacgata
gcggtgctgcagggtagcgatcaggccgcggcggcacgggcgctggcggagtatttcgcc
tcgccccaggggatccgcgcgtttaccgatcgcggctatttgccgctggcgaagtag

KEGG   Edwardsiella piscicida C07-087: ETAC_12290Help
Entry
ETAC_12290        CDS       T02509                                 

Gene name
modA
Definition
(GenBank) molybdate transporter periplasmic protein
  KO
K02020  molybdate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12290 (modA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12290 (modA)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_12290 (modA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AGH74579
Position
complement(2769074..2769841)
Genome map
AA seq 255 aa AA seqDB search
MKAWNRLLAGAVLAVGVCQGAQAEDKVTVFAAASLTNALQEIAAQYQQGKQVSIVTSFAS
SSTLARQIDQGAPADLFISADQKWMDYAIDKHAVVADTRYTLLGNQLVLVAPADSKLGQM
TINAQTHWKKLLDGGRLAVGDPDHVPAGIYAKASLQALGAWETLSPLMARANDVRAALAL
VERGEAPLGIVYGSDAVASKKVKVVGVFPADSHKPVEYPMAIVKGKQSPAVNAFYDYLKG
PQAATIFTRYGFTPR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtggaatagattactggcgggggccgtactggccgtcggcgtctgccagggc
gcccaggccgaagacaaggtgacggtctttgccgccgcctccctgaccaacgcgctgcag
gagattgcggcgcagtatcagcagggcaagcaggtgagcatcgtcacctcgttcgcctct
tcctcgacgctggcgcgtcagatcgatcagggggcgccagccgatctgttcatctccgcc
gatcagaagtggatggactacgccatcgacaaacacgccgtggtggccgatacccgctat
accctgctggggaatcagctggtgctggtggcgccggctgacagtaagctgggtcaaatg
accattaatgcgcagactcactggaaaaaactgctggacggcggccgtctggcggtgggc
gatccggaccacgtgccggcggggatctatgccaaggcgtcgctgcaggcgctgggagcc
tgggagacgctatcgccgctgatggcgcgggccaacgacgtgcgtgcggcgctggcgctg
gttgagcgcggcgaggcgccgctggggatcgtgtatggctccgacgcggtggccagcaaa
aaggtgaaggtggttggggtcttcccggcggacagccataagccggtggagtacccgatg
gcgatcgtcaaggggaaacagagcccggcggtcaacgccttctacgattatctgaagggg
ccgcaggcggccacgatctttacccgctacggcttcaccccgcgttaa

DBGET integrated database retrieval system