KEGG   Edwardsiella piscicida C07-087: ETAC_04415Help
Entry
ETAC_04415        CDS       T02509                                 

Definition
(GenBank) protein NifC
  KO
K02018  molybdate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04415
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1641
Motif
Other DBs
NCBI-ProteinID: AGH73014
Position
1019305..1020093
Genome map
AA seq 262 aa AA seqDB search
MRALALLPLLLLLALIVGSLAALLGQIDIAMLAALLRDPEIRFALGLSLSTALLSLALAC
LIALPAAWAMVRVPLPGKRWLNLLLDLPMVTPPLVTGIGLLLLLGHQGPLGGWLPGLAQR
LFSPLGIVIAQTYVATAILLRSAGAALASIDRAWLETAHNLGLAPLATFLLVEIPLVWRA
LVSGAVLALSRALGEFGATLMLAGATRMKTETLPIAVYLNIAGGDFSAAVGCALLLILLA
FALLLLLHGVRPPKEKGKYAAY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgctggcgctgctgcccctgctgctgctgctggcactgatcgtcggttcgctg
gccgctctgctggggcagatcgatattgccatgctggcggcgctgctgcgcgatccggag
atccgtttcgcgctggggctctccctgtcgacggcgctgctgtcgctggcgctggcctgc
ctgattgcgctgccggcggcctgggcgatggtgcgggtcccgctgccgggaaaacgctgg
cttaatctgctgctcgatttgccgatggtgacgccgccgctggtgaccggcatcggcctg
ctgctgctgctgggacatcaggggccgctggggggctggttgcctggactggcgcagcgg
ctcttttccccgctggggatcgtcatcgcccagacctatgttgccacggccattttgctg
cgcagcgccggcgccgccttggccagcatcgatcgcgcctggctggagaccgcccataat
ctggggctggcgccgctggcgacctttctgctggtggagatcccgctggtgtggcgcgcc
ctggtcagcggggcggtgctggccctgtcgcgggcgctgggggagtttggcgccacgctg
atgctggcgggcgcgacgcggatgaaaacggagaccctaccgatcgccgtgtatctgaat
atcgccggcggcgacttctctgccgcggtcggctgtgccctgctgttgatcctgctggcg
tttgccctgctgctgctgctgcacggcgtgcgcccgccgaaggaaaagggaaaatatgct
gcatattga

KEGG   Edwardsiella piscicida C07-087: ETAC_12285Help
Entry
ETAC_12285        CDS       T02509                                 

Definition
(GenBank) Molybdenum transport system permease ModB
  KO
K02018  molybdate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12285
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_12285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH74578
Position
complement(2768372..2769064)
Genome map
AA seq 230 aa AA seqDB search
MFLSPYEWEAVVLSLQVAGTAVIFSLPLGIATAWVLVRYRFPGKSLLDSVIHLPLVLPPV
VIGYLLLLAMGRKGVIGAWLYSWFGFSFSFSWHGAALASAVVAFPLMVRAIRLALASVDR
RLEQAARTLGASPLRVFFTITLPLSFPGILAGTVLAFARSLGEFGATITFVSNIPGETRT
IPLAMYTLIETPGAESEAARLCAIAIALSLLSLMLSEWLARWSQKRLGGA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcagtccctacgaatgggaggccgtggtgctcagcctgcaggtggcgggcacc
gcggtgatcttcagtctgccgctgggcattgctaccgcctgggtgctggtgcgctaccgg
ttccccggtaagtcgctgttggacagcgtgatccatctgccgctggtgctgccgccggtg
gtcatcggctacctgctgctgttggcgatggggcgcaagggggtcatcggcgcctggctg
tacagctggtttggcttcagcttcagcttcagctggcacggcgccgccctggcgtcggcg
gtggtggcctttccgctgatggtgcgcgccatccgtctggcgctggcctcggtggatcgg
cgcctggagcaggcggcgcgcacgctgggcgctagcccgctgcgggtcttttttaccatc
acgctgcccctgtcgtttcccggcattctggccgggacggtgctggccttcgcccgctcg
ctgggcgaatttggcgccaccattaccttcgtatccaacattcccggtgaaacgcgcacc
atcccgctggcgatgtataccctgatcgagacgccgggcgccgaatcggaggcggctcgg
ctgtgcgcgatcgccatcgcgctgtcgctgctgtcgctgatgctctccgagtggctggcg
cgctggagtcagaaacggctggggggtgcctga

DBGET integrated database retrieval system