KEGG   Edwardsiella piscicida C07-087: ETAC_04420Help
Entry
ETAC_04420        CDS       T02509                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02017  molybdate transport system ATP-binding protein [EC:7.3.2.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_04420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_04420
Enzymes [BR:etc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     ETAC_04420
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_04420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 AAA_33 AAA_29 AAA_19 AAA_23 SbcCD_C AAA_28 AAA_30 AAA_25 DUF3584 AAA_18 AAA FtsK_SpoIIIE NACHT RsgA_GTPase ATP_bind_1 MobB Zeta_toxin cobW T2SSE
Motif
Other DBs
NCBI-ProteinID: AGH73015
Position
1020080..1020700
Genome map
AA seq 206 aa AA seqDB search
MLHIDALHCAILRGVSLSAAAAGCTAVCGASGSGKTTLLRAVAGHLPYRGSVRVAGRPID
GLPPWRRPCRHLNQRLYLFPFLSVEQNLALAQFAAGRPRCAADRLSLLRELEVDHLAQRY
PQQLSGGEQQRVALARALVSAPPLLLLDEPFSSLDWPLRRRLWGCLRRVQRQRAMTLLLV
SHEPREVDALADACYQLQAGQLRQLT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatattgatgcgctgcactgcgcgatcctgcgcggcgtcagcctgtccgccgcc
gccgcgggctgtaccgccgtctgcggagcctctggcagcggcaagaccaccctgctgcgg
gcggtcgccggccatctgccgtaccggggcagcgtgcgtgtggcggggcgtcctatcgat
gggctgccgccctggcgtcgcccctgccgccacctgaatcagcggctgtatctgtttccg
tttctcagcgtagagcaaaatttggcgctggcgcagtttgcggccggacggccgcgctgc
gcagcggatcgcctgtcgctgctccgggagctggaggtggatcatctggcgcagcgctat
ccccagcagctgtccggcggcgagcagcagcgggtcgcgctggcgcgtgccctggtgagc
gctccgccgctgctgctattggatgaacccttctccagcctggactggcccctgcgtcgg
cggctgtggggctgcctgcgtcgggtgcagcgacagcgtgccatgacgctgctgctggtc
agccacgagccgcgcgaggtcgacgccctggccgatgcctgctatcagctacaggcgggg
cagctgcggcagctgacctag

KEGG   Edwardsiella piscicida C07-087: ETAC_12280Help
Entry
ETAC_12280        CDS       T02509                                 

Gene name
modC
Definition
(GenBank) molybdate transporter ATP-binding protein
  KO
K02017  molybdate transport system ATP-binding protein [EC:7.3.2.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12280 (modC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12280 (modC)
Enzymes [BR:etc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     ETAC_12280 (modC)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    ETAC_12280 (modC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE AAA_23 AAA_21 AAA_29 RsgA_GTPase SMC_N AAA_16 MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-ProteinID: AGH74577
Position
complement(2767312..2768370)
Genome map
AA seq 352 aa AA seqDB search
MLHIELRQRLGDLDLRVDADLPGEGITAIFGLSGAGKTSLINAIGGLTRPQQGRIVLNGR
TLVDCERGICLPPEQRRIGYVFQDARLFPHYRVRGNLTYGMAAQMRGQFDDIVGLLGIDA
LLDRFPRTLSGGEMQRVAIGRALLTAPELLLMDEPLASLDLPRKRELLPYLERLARDVRT
PILYVSHSMEEILRLAQYVLLLDRGQMRAFGRLEEVWASSALRPWLQKEEPSSVLNVRLD
RHHPHYAMSALALGAQCLWVSRQAGEPGDRLRLRINAADVSLVREVPRASSIRNILAVSV
VELLEVEGQVDVKLALEGETLWARITPWARDDLGLAPGQRLYAQIKSVSINQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatattgagcttcgccagcgcctgggcgatctggatctgcgggtcgatgccgat
ctgccgggcgaggggatcaccgccatcttcggcctgtccggggcgggcaagacctcgctg
attaacgccatcggcggactgacgcgcccgcagcaggggcgcatcgtgctcaacgggcgt
acgctggtggactgcgagcgcgggatctgcctgccgccggagcagcggcgcatcggctat
gtgttccaggacgcgcgcctgtttccccactaccgggtgcgcggcaacctgacctatggc
atggcggcgcagatgcgtgggcagttcgacgatatcgtcggcctgctgggcatcgacgcg
ctgctggatcgcttcccgcgcaccctctccggcggcgagatgcagcgggtggccattggt
cgcgccctgctgactgcgccggagctgctgctgatggatgagccgctggcctccctggat
ctgccgcgtaagcgtgagctgctgccctatctggagcgtctggcgcgcgatgtgcgcacg
cccatcctgtacgtcagccacagcatggaggagatcctgcgtttggcgcagtacgtgctg
ctgctggatcgcgggcagatgcgcgcctttggccgtctagaggaggtctgggccagcagc
gccctgcgcccctggctgcaaaaggaggagccgagcagcgtgctcaacgtgcgcctcgat
cgccaccatccgcactatgcgatgagcgccctggcgctgggcgcacagtgcctgtgggtg
agccgtcaggcgggcgagccgggcgatcggctgcggctgcgcatcaacgcggcagacgtc
tcgctggtgcgggaggtgccgcgcgccagcagcatccgcaatattctggcggtcagcgtg
gtcgagctgctggaggtggaggggcaggtggacgtgaagctggcgctggagggggagacc
ctgtgggcgcggatcaccccctgggcgcgcgacgatctggggctggcgccgggccagcgg
ctgtacgcccagattaagagcgtgtccatcaaccaatag

DBGET integrated database retrieval system