KEGG   Edwardsiella piscicida C07-087: ETAC_04475Help
Entry
ETAC_04475        CDS       T02509                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00240  Pyrimidine metabolism
etc00760  Nicotinate and nicotinamide metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_04475
   00240 Pyrimidine metabolism
    ETAC_04475
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAC_04475
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ETAC_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AGH73026
Position
1031681..1032355
Genome map
AA seq 224 aa AA seqDB search
MKYSWILFDADETLFRFDAYQGLRLMFSRFNVDFSVEDYQAYEAVNQPLWVDYQEGRITS
RRLQEVRFEGWAQRLNMTACAINDAFVQAMTEICEPLPGARELVLSLRGRVRMGIITNGF
TAMQNERLQRTGLSDAFATLVVSEEVGVAKPDVAIFEHAFALMDNPPREQILMVGDNPHS
DILGGINAGIDTCWLNTRDEPAPQGITPSYQVGSLRELQQILLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacagttggattttgtttgatgcggatgaaacgctgttccgctttgatgcctat
caagggctacgcctgatgttttcccgctttaacgtcgatttcagcgtggaggattaccag
gcctatgaggcggtaaatcagccgctgtgggtggattaccaggaggggcggatcacctcg
cgtcggctgcaggaggttcggtttgagggatgggcccagcgcctcaatatgacggcctgc
gcgattaacgatgcctttgttcaggcgatgaccgagatctgcgagccgctgccgggcgcc
cgtgaactggtgctctccctgcgggggcgggtgcggatgggcatcatcaccaacggcttt
accgccatgcagaatgagcgtctgcagcgcactggcctgagcgatgccttcgcgaccctg
gtggtctcggaggaggtcggggtcgccaagccggacgtggcgatcttcgaacatgccttt
gccctgatggataatcccccgcgtgagcagatcctgatggtgggggataatccgcactcc
gatattctgggcgggattaatgccggtatcgatacctgctggctgaatacccgcgatgag
ccggctccgcaggggatcacgcccagctaccaggtcggatcgctgcgcgagctgcagcag
attttgctggcctga

KEGG   Edwardsiella piscicida C07-087: ETAC_04925Help
Entry
ETAC_04925        CDS       T02509                                 

Gene name
ushA
Definition
(GenBank) bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00240  Pyrimidine metabolism
etc00760  Nicotinate and nicotinamide metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_04925 (ushA)
   00240 Pyrimidine metabolism
    ETAC_04925 (ushA)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAC_04925 (ushA)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ETAC_04925 (ushA)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     ETAC_04925 (ushA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-ProteinID: AGH73112
Position
1133178..1134836
Genome map
AA seq 552 aa AA seqDB search
MKFTYRGAACAIALTLALTPGWSLAWEKDKTYNLTILHTNDHHGHFWQSEQGEYGLAAQK
TLVDRLRAEIAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFD
NPLSVLRQQQKWADFPLLSANIYAQDSGKRLFQPYQMFDRQGIRIAVIGLTTDDTAKIGN
PEYLKNIEFRPPAAEAKGVVEQLRANEKPDVVIAATHMGHYDNGEHGSNAPGDVEMARAL
PAGYLDMIVGGHSQDPVCMAQENRKQANYVPGTPCAPDRQNGTWIVQAHEWGKYVGRADF
TFRNGELTLQRYQLIPVNLNRQEKQADGSKTRIYYTEAIPQDTAMLKLLTPFQDQGQAAL
GVKIGSVEGRLEGDRSKVRFEQTNMGRLLLAAQMERTHADLGVMSGGGVRDSMDSGDISY
KDVLKVQPFGNTVAYVDMSGAELEKYLGVVANKKPNSGAYAQFANLSLTADGKQGVSDVK
IGGKPLVADRTYRVALLSFNASGGDDYPNVTQHPGYVNTGFVDAEVLKDYIQRHSPIKAT
DYQPNGEIVYRD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacctatcggggtgccgcctgcgcgatcgcgctaacgctggcgctgacgcca
ggctggtcgctggcctgggaaaaagataaaacctataacctgaccattctgcataccaac
gatcaccacggccatttctggcagagcgagcagggcgaatatggcctggctgcccagaaa
acgctggtggatcgcctgcgcgccgagattgccgccgagggcggcagcgtgctgctgctg
tcgggcggcgatatcaataccggggtgccggagtccgatctgcaggatgccgagcccgat
tttcgcggcatgaacctggtgggctacgatgcgatggccatcggcaaccacgagttcgac
aatccgctgagcgtgctgcgccagcagcagaagtgggccgatttcccgctgctgtcggcc
aatatctatgcgcaggatagcggcaagcgcctgttccaaccttatcagatgttcgatcgc
caggggatccgcattgcggtgatcggcctgaccaccgacgatacggccaagataggcaac
cctgaatacctgaagaacatcgagttccgccccccggcggcggaggccaagggcgtggtc
gaacagctgcgggccaacgagaagcctgacgtggtgatcgccgcgacgcacatgggtcac
tacgacaacggcgagcacggctccaacgccccgggcgatgttgagatggcgcgcgcgctg
ccggcgggctacctcgatatgatcgttggcggtcactcgcaggatccggtgtgcatggca
caggaaaaccgtaagcaggcgaactatgtccccggtacgccctgcgcgccggatcgccag
aatgggacctggattgtacaggcccatgagtgggggaaatatgtcgggcgggccgacttc
accttccgtaacggggagctgaccctgcagcgctaccagctgatcccggtgaacctcaat
cggcaggagaagcaggccgacggttcgaagacgcggatctactataccgaggcgatcccg
caggatacggcgatgctgaagctgctgacgccgttccaggatcaggggcaggccgcgctg
ggggtgaagatcggcagcgtagaggggcgtctggagggggatcgcagcaaggttcgcttt
gagcagaccaacatggggcgcctgctgctggcggcgcagatggagcgaacccatgccgac
ctgggcgtgatgagcggcggcggcgtgcgtgactcgatggacagcggcgatatcagctat
aaggatgtgcttaaggtgcagccgttcggcaataccgtcgcctatgtcgacatgagcggc
gcggagctggagaaatacctgggcgtcgtcgccaataaaaagcccaactccggcgcctat
gcgcagtttgccaatctgagcctgacggcggacggcaagcagggggtcagcgatgtgaag
atcggcgggaaaccgctggtggccgatcggacctatcgcgtggcgctgctgagctttaac
gccagcggcggcgatgactaccccaatgtgacccagcatccgggctacgtgaacaccggc
ttcgttgacgccgaggtgctgaaggactatatccagcgccattcgccgatcaaggcgacg
gactatcagccgaacggtgagatcgtgtatcgcgattaa

KEGG   Edwardsiella piscicida C07-087: ETAC_13850Help
Entry
ETAC_13850        CDS       T02509                                 

Gene name
surE
Definition
(GenBank) 5'(3')-nucleotidase/polyphosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00240  Pyrimidine metabolism
etc00760  Nicotinate and nicotinamide metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_13850 (surE)
   00240 Pyrimidine metabolism
    ETAC_13850 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAC_13850 (surE)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ETAC_13850 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AGH74891
Position
complement(3121503..3122267)
Genome map
AA seq 254 aa AA seqDB search
MRILLSNDDGVTAPGIQTLAEALREFAQVQVVAPNRNRSGASNALTLESPLRSETLANGD
ISVIDGTPTDCVYLGVNALMRPRPDIVIAGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGERHYDTAAAVTCRLLRMLSDAPLRSGRILNVNVPDVPLAAIRGWRVTRCGSRH
PAQTVIHQQDPRGKPLMWIGPPGAKQDAGEETDFAAVAAGYISVTPLQVDLTAHGARERL
AEWLGRVDKGGAAW
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcttgctgagtaatgatgatggcgtaacggctcccggtattcagacgctggcg
gaggcgctgcgtgagtttgcccaggtgcaggtcgtcgccccgaaccgcaaccgcagcggg
gcctccaatgccctgacgctggagtcgccgctgcgcagcgaaaccttggccaacggcgac
atcagcgtgatcgacggcacgccgaccgactgcgtctatctgggggtcaatgcgctgatg
cgcccgcgcccggatatcgtgatcgccggcatcaacgccggtcctaacctgggcgacgac
gtgatctactccggcacggtggcggcggcgatggaggggcgtcatctgggctttccggcg
ctggcggtgtcgctggacggcgagcgccactatgacacggcggcggcggtgacctgccga
ctgctgcgtatgctctccgatgcgccgctgcgcagcgggcgcatcctgaacgtgaacgtg
ccggacgttccgctggcggcgatccgcggctggcgcgtgacccgctgcggcagtcgtcat
ccagcgcagacggtgatccatcagcaggatccgcgcggtaagccgctgatgtggatcggc
ccgccgggggccaaacaggacgccggcgaagagaccgatttcgccgccgtggcggcgggc
tatatctccgtgacgccgctgcaggtggatctgaccgcccacggcgcgcgtgagcggttg
gcggagtggctgggccgggtggataagggcggtgcggcatggtag

KEGG   Edwardsiella piscicida C07-087: ETAC_15600Help
Entry
ETAC_15600        CDS       T02509                                 

Definition
(GenBank) GMP/IMP nucleotidase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00240  Pyrimidine metabolism
etc00760  Nicotinate and nicotinamide metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_15600
   00240 Pyrimidine metabolism
    ETAC_15600
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAC_15600
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ETAC_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AGH75241
Position
3521389..3522090
Genome map
AA seq 233 aa AA seqDB search
MVPTLDWNDIDTVLLDMDGTLIDLAFDNYFWLTLVPQTLSEARGISRADAQALIQREYQA
VAHTLNWYCFDYWRERLGLDIHRMTLEQGTRVQVRQDTLPFLNALRASGRRTILLTNAHP
HGLAMKMAQTGLDSHLDILYSTHRFGYPKEDQRLWRAVQHQCGLDPARTLFIDDAEPILD
AAHQFGIRYCLGVSNPDSGRPEKRFARHPAMSDYRALLPAIVAGGPDTDRRAP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggttcccaccctcgactggaatgacatcgataccgtcctgttggatatggacggcacg
ctgatcgatctggcctttgataactacttttggctaacgctggtgccgcagaccttaagc
gaggcacgcggcatttcccgcgccgatgctcaggcgctgatccagcgggagtaccaggcg
gtagcccatacgctcaactggtactgtttcgactactggcgcgagcgcctggggctggac
attcaccgcatgaccctggaacaagggacgcgggtacaggtgcgtcaggacacgttaccc
tttcttaatgccctgcgcgccagcgggcgccgtaccattctgctgaccaacgcccacccg
catgggctggcgatgaagatggcgcagaccgggctggatagccaccttgatatactctat
tccacccaccgctttggctatcccaaagaggatcagcgcctgtggcgagcggtacagcat
cagtgcgggctggatccggccagaacgctgttcattgacgacgccgaaccgatcctcgac
gccgcgcaccagttcggtatccgttactgcctgggcgtcagtaatcccgactccggcagg
ccggaaaaacgctttgcccgccatccggcgatgagcgactaccgcgccctgctgccggcc
atcgtcgccggtgggcccgatacagacaggagggcaccatga

DBGET integrated database retrieval system