KEGG   Edwardsiella piscicida C07-087: ETAC_04545Help
Entry
ETAC_04545        CDS       T02509                                 

Definition
(GenBank) maltodextrin glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00052  Galactose metabolism
etc00500  Starch and sucrose metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ETAC_04545
   00500 Starch and sucrose metabolism
    ETAC_04545
Enzymes [BR:etc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ETAC_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGH73040
Position
1050376..1052166
Genome map
AA seq 596 aa AA seqDB search
MFNAWHLPVAPYVRCRGDDMVVTLLLTGEDLPQRVLLRCEPDNEEWLLPMRRHRRRAGVC
YRARLSLREGEPLRRYCFKLLWADRQRWFTSLGLQATPPGQEAQFAVSVPSPYPEWVADQ
VFYQIFPDRFARGAAAENAPHPGWRDWTTPLDATADAHTFYGGDLDGVTARLPYLRSLGV
TALYLNPIFSAPSNHKYDTADYYRVDAGLGGDPALIRLRQATAQAGIRLLLDGVFNHTGD
THRWFDRPRRGEDGACHHPASPQRERYSFDADGRALGWKGEASLPKLDYASPRVVDSIYR
ADDSVMRYWLRPPYAIDGWRLDVIHMLGEGGGARGNLHHLAEMYRAVKAENPQAYVLGEH
FGDARRWLQAGVEDGAMNYMGFALPLRAFLAGVDVAYQPIRLSAAQCAEWMASYRAGLSQ
TQQLCQFNQLDSHDTARFITLLRGNRQRMMLALTWLFTWIGAPCLYYGDEIGLAGENDPY
CRAPFPWEPAQWDGALLSLCRQLAQMRRRYAALRRGGCQIIHADGETLLFIRRLARQSIL
VAIQRAGAGALTLPCTPLLPAGAWRALCGAGQLEAGAETLALRLPAESASVWVLNG
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatgcctggcacctgccggtcgcgccctatgtgcgttgccgcggagacgatatg
gtggtgacgctgctgctgacgggtgaggatctgccgcagcgggtactgctgcgctgtgaa
ccggacaatgaggagtggctgctgccgatgcgccgccaccggcgccgcgcgggcgtgtgc
tatcgggcccgcctctcgctgcgggagggcgaaccgctgcggcgctactgttttaagctg
ctgtgggccgatcgccagcgctggtttacgtccttggggctgcaggcgacgccgccgggt
caggaggcgcagtttgccgtcagcgtaccgtcgccctatcccgagtgggttgccgatcag
gtgttttaccaaatttttcccgatcgcttcgcccgcggcgccgcggcggagaacgcgccg
cacccgggctggcgcgactggacgacgccgctggacgcgacggcggatgcccacacgttc
tacggcggcgatctggatggcgtcaccgcacggctgccctatctacggtcgctgggggtt
accgcgctctatctgaaccccatcttcagcgcgccgagcaaccataaatatgataccgcc
gactattatcgagtggatgcggggctgggcggcgatccggcgctgatccggctgcggcaa
gccaccgcccaggcgggtatccgcctgctgctggacggcgtattcaatcataccggagat
acccaccgctggttcgatcgcccgcggcgcggcgaggatggcgcctgtcaccaccccgcg
tcgccgcagcgtgaacgctacagctttgacgccgacgggcgggcgctgggctggaaaggc
gaggcctccctgcccaagctggactacgccagcccacgggtggtcgacagcatctatcgg
gcggatgacagcgtgatgcgctattggctgcgtccgccctatgccattgatggctggcgg
ctggacgtcatccacatgctgggcgaagggggcggtgcccggggtaatctgcatcatctg
gcggagatgtaccgggcggttaaggccgaaaatccccaggcctacgtgctgggcgagcac
tttggcgacgcgcgccgctggctgcaggccggggtagaggacggcgcgatgaactacatg
ggctttgccctgccgctgcgcgcgtttctcgccggcgtggacgtcgcttaccagcccatt
cggctcagcgcggcccagtgcgctgaatggatggcgtcataccgcgccgggctgagccag
acgcagcagctgtgccagtttaaccagctggatagccacgataccgcccgttttattacc
ctgctacggggaaaccgtcagcggatgatgctggcgttgacctggctgtttacctggata
ggggctccctgcctgtactatggcgacgaaattggcctggcgggggagaacgatccctac
tgccgtgcgccgtttccctgggagcctgcgcagtgggatggcgcgctgctcagcctgtgc
cgtcagctggcgcagatgcgtcgccgatacgccgcgctgcgccgcggcggctgtcagata
atccatgccgatggcgagacgctgctgtttatccgccggctggcgcggcagtcgattctg
gtggctatccagcgcgccggcgcgggtgcgctgacgctgccctgtacgccgctgctgccg
gcgggggcatggcgcgcgctgtgcggcgccgggcagctggaggcgggggcggagaccttg
gcgctgaggctccccgcagagagcgccagcgtgtgggtgctgaatgggtga

KEGG   Edwardsiella piscicida C07-087: ETAC_14535Help
Entry
ETAC_14535        CDS       T02509                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00052  Galactose metabolism
etc00500  Starch and sucrose metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ETAC_14535
   00500 Starch and sucrose metabolism
    ETAC_14535
Enzymes [BR:etc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ETAC_14535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5110 Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: AGH75028
Position
3280395..3280979
Genome map
AA seq 194 aa AA seqDB search
MAPASAIVIEPLAGDLAAPISRSDPPNRGPDHQLSVQQQRAARRRVWLPDNGGGWYDFYS
EAWFCGGQWITLDAALERLPLLVRAGAGLPLSERVRHVDSAADDRRELRLFPRQGCGSDS
GLLFEDDGESWGYQQGNALWLTWEMTCSATQIALSVTPRGQYRPAWRQLRVTLPKGERRQ
LLINGVATDAWHID
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttggcgccggcctcagcgatcgtcatagagcccctcgctggagacctcgccgcgccgatt
tcccggtcggatccgccgaaccgaggccctgaccaccagctctccgtacagcagcagcga
gccgcacggcgccgggtctggctgcccgataacggcggcggctggtatgacttttatagc
gaggcgtggttctgcgggggacagtggatcacgctggacgccgcgctggaaagactgccg
ctgctggtgcgcgccggcgccggattgccgctgagcgagcgcgtccgccacgtcgatagc
gccgccgacgatcgccgcgaactcaggctattcccgcggcagggctgcggcagcgattca
ggcctgctgtttgaggacgacggcgaaagctggggctaccagcagggaaatgcgctgtgg
ctgacgtgggagatgacctgcagcgccacgcagatcgcgctcagcgtgacgccgcgcggc
cagtaccgaccggcctggcgccagctgcgggtcaccctacccaagggggagcgccgtcag
ctgctgatcaacggcgtcgcgaccgacgcgtggcacatcgactaa

DBGET integrated database retrieval system