KEGG   Edwardsiella piscicida C07-087: ETAC_04675Help
Entry
ETAC_04675        CDS       T02509                                 

Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00900  Terpenoid backbone biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Module
etc_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAC_04675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:etc01006]
    ETAC_04675
Enzymes [BR:etc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ETAC_04675
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ETAC_04675
Prenyltransferases [BR:etc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ETAC_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGH73064
Position
complement(1079347..1080252)
Genome map
AA seq 301 aa AA seqDB search
MASFEQQMKTCRQRADAALIQALDTLPFADGPLVGAMRYGALLGGKRLRPYLVYATGGLF
GCSPTALDAPAAAVECIHAYSLLHDDLPAMDDDDLRRGQPTCHIKFGEAHAILAGDALQT
LAFSILADGPMPGVADRDRLQMLSELAHASGVAGMCGGQALDLEAEGRHVALAALEQIHR
HKTGALIRCAVRMGALAGGDAGRRALPALDRYAAAIGLAFQVQDDILDVVGDSSKTGKRQ
GADQQLDKSTYPALLGLDQARQKAATLLDEALQALAELEQRHNLDTQALKSLASFIVERD
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttttgaacaacagatgaaaacctgccgccagcgggcggatgcggcgctgatc
caggcgctggacaccctaccctttgccgacggaccgctggtgggcgccatgcgctacggc
gccctgctgggcggcaagcgcctgcgcccctatctggtgtacgccaccggtggcctgttt
ggctgctcgccgacggcgctggacgcgccggccgccgccgtggaatgcattcacgcctac
tcgctgctgcacgacgatctgcccgcgatggacgatgacgatctgcgccgcggccagccg
acctgccatatcaagtttggcgaggcccatgccatactggccggcgacgcgctgcagacc
ctggccttttccattctggccgacggcccgatgcccggcgttgccgatcgcgaccgccta
caaatgctgagcgagctggcccacgccagcggcgtcgccggcatgtgcggcggccaggcg
ctcgatctggaggccgaggggcgacacgtcgcgctggcggcgctggagcagatccatcgc
cataaaaccggggcgctgatccgctgcgcggtgcgcatgggggccctggccggcggcgat
gcgggacggcgcgccctcccggccctcgaccgctacgccgccgccatcggcctggcgttc
caggtacaggatgacattttggacgtggtgggcgacagcagcaaaaccggcaagcgccag
ggggcggatcagcagctggacaagagcacctatccagccctgctcggcctggatcaggcc
cggcagaaggccgcgacgctgctggatgaagcgctgcaggcgttggcagagcttgaacaa
cgccacaacctggatacgcaggcgctaaaatccttagccagttttatcgttgagcgcgat
aattaa

DBGET integrated database retrieval system