KEGG   Edwardsiella piscicida C07-087: ETAC_04990Help
Entry
ETAC_04990        CDS       T02509                                 

Definition
(GenBank) Queuosine biosynthesis QueD
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00790  Folate biosynthesis
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAC_04990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etc03016]
    ETAC_04990
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     ETAC_04990
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     ETAC_04990
Transfer RNA biogenesis [BR:etc03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ETAC_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS
Motif
Other DBs
NCBI-ProteinID: AGH73125
Position
complement(1146923..1147285)
Genome map
AA seq 120 aa AA seqDB search
MTTTLFKEFQFEAAHRLPHVPQGHKCGRLHGHSFLVRIEITGEVDPYTGWVMDFADLKAR
FQPIYDQLDHHYLNEIAGLENPTSEVLARWIWDQLKPCLPLLSAVRVKETCTAGCTYRGQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaccctgtttaaagagtttcagtttgaagcggcccaccgtttgccgcacgta
ccgcagggacacaagtgtggccgtttgcacggccactcgtttctggtgcgcatagagatc
accggtgaggtcgacccctacaccggttgggtaatggactttgccgatctgaaagcgcgc
ttccagccgatctatgatcagctggatcaccactatctcaatgagatcgccgggctggaa
aacccgaccagtgaggtgctggcccgctggatttgggatcagctcaagccgtgcctgccg
ctgctgagcgcggtgcgagtcaaagagacctgcaccgccggctgcacctatcgcggccag
tga

DBGET integrated database retrieval system