KEGG   Edwardsiella piscicida C07-087: ETAC_05020Help
Entry
ETAC_05020        CDS       T02509                                 

Definition
(GenBank) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Module
etc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_05020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_05020
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     ETAC_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C ASL_C2
Motif
Other DBs
NCBI-ProteinID: AGH73131
Position
complement(1153903..1155267)
Genome map
AA seq 454 aa AA seqDB search
MGSSVFDSVLLNNAWSTEEMRLIFSDETRIQKWLDYEAALALEQGELGIIPADAARTIAD
SARLEKLDFAYLLEQLRLTRHPLVPAIRALERACPAGAGEYVHFGPTTQDVIDTGLILQL
QQAHGVFLRDVKTIGRSLYQLSARHRDTPMSGRTLALQALPITFGHKSAIWLAEMGRHYQ
RLRALEPRLFVGSMVGAVGTQASFGERASQLEQRVLARLGLETPEISWQPARDRLSEYGM
TIGLIAATLGKIANEILLLAHNEVDELTEFFAPGQVGSSTMPHKRNPAVAENAACVSNAL
KANLSVLSDMMKHQHERDGAVWKTEWKIMPELCLMLSVILDNMRSVLSGLTVNGTRMRAN
MDLLGGFMLAERVMFALAEKAGKQSAHELVYAAAMRGQEQGLPFSQVLYDDSRISAHLTR
PELEALLDPTTYVGHAPRQVDRLLAAVDSAGWLQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaagtgtgtttgattccgtgttattaaataatgcctggtcgaccgaggagatg
cgcctgattttctccgatgagacccggatccagaaatggctggactatgaagccgcgctg
gccctggagcagggcgagctgggcatcattcccgccgacgctgcccgcaccatcgccgac
agcgcccggctggaaaaactggacttcgcttatctgctggagcagctgcgcctgacccgt
catccgctggtgccggcgatccgggcgctggagcgggcttgcccggccggggcgggcgag
tatgtccactttggccccaccacccaggatgtcatcgacaccgggctgatcctgcagcta
cagcaggcacacggcgtatttctgcgcgacgtaaagaccattggccgcagcctgtatcag
ctgagcgcgcgccatcgcgataccccgatgagcggacgcaccctggccctgcaggcgctg
ccgatcacctttggccacaaaagcgcgatctggctggcggaaatggggcgccactatcag
cgcctgcgcgcgctggagccacgcctgtttgtcggcagtatggtcggcgccgtcggaacc
caggcctcctttggcgaacgggcctcgcagctggagcaacgggtgctggcccggcttggg
ctggaaacgccggagatctcctggcagccggcgcgcgatcgcctgagcgaatatggtatg
acgatcgggcttatcgcggcgacgctcggcaagatagccaacgagatcctgctgctggcc
cataacgaagtcgacgagctgaccgagttctttgccccggggcaggtcggatcgtccacc
atgccgcataagcgcaaccccgccgtggcggagaatgccgcctgcgtcagtaacgccctc
aaggccaacctgagcgtgctgagcgacatgatgaaacaccagcacgagcgcgatggcgca
gtatggaagaccgagtggaagattatgccggagctgtgtctgatgctctcggtgatcctg
gacaacatgcgctctgtgctcagcgggttgacggtcaacggtacgcggatgcgcgccaat
atggatctgctcggcggcttcatgctggcggagcgcgtcatgtttgcgctggcggagaag
gcgggaaagcaaagcgcccatgagctggtgtacgcggcggcgatgcgcgggcaggagcag
gggctccccttcagccaggttctgtatgacgacagccgcatcagcgcccatctcacccgc
ccagagctggaggcgttgctcgatccgaccacctatgtcggtcacgccccgcggcaggtc
gatcgcctgctggccgcggtcgacagcgcaggctggctgcagtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_09770Help
Entry
ETAC_09770        CDS       T02509                                 

Definition
(GenBank) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Module
etc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_09770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_09770
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     ETAC_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C
Motif
Other DBs
NCBI-ProteinID: AGH74075
Position
2217647..2219017
Genome map
AA seq 456 aa AA seqDB search
MELSSLTAVSPIDGRYGDKVSALRPIFSEFGLLKFRVQVEVRWLQKLAACAEIGEVPAFD
ADANAFLDRIVDQFSEEDARRIKTIERTTNHDVKAVEYFLKEKVADQPALHAVSEFIHFA
CTSEDINNLSHALMLNSAREEVLKPVWRQLIDTLRDLAQRYRDIPLMARTHGQPATPSTV
GKEFANVAYRLERQFRQLTQVEILGKINGAVGNYNAHLAAYPQIDWHAFSESFVTSLGIQ
WNPYTTQIEPHDYIAELFDCVARFNTILLDFDRDVWGYIALNHFKQRTIAGEIGSSTMPH
KVNPIDFENSEGNLGLSNALLGHLASKLPVSRWQRDLTDSTVLRNLGVGLGYALIAYAST
LKGLSKLEVNQDHLLDELDHNWELLAEPVQTVMRRYGIEKPYEKLKELTRGKRVDAAGMQ
RFIDGLALPEEEKARLKAMTPAAYTGAAAALVDKLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaattatcctccctgaccgccgtatccccgatcgacggccgctacggcgacaaagtc
agtgccctgcggccgatctttagtgagttcggcctgctgaagtttcgcgtccaggtagaa
gtgcgttggctgcaaaaactggccgcctgcgcagaaatcggcgaagttcccgcttttgac
gcggacgcaaacgctttccttgaccggatcgtcgaccaattcagcgaagaggatgcccgc
cgcatcaaaaccatcgagcgtaccaccaatcacgacgtgaaggcggtcgagtacttcctg
aaagaaaaagtggctgaccagcccgcgctgcacgcggtctccgagtttatccacttcgcc
tgcacctccgaggatatcaacaacctctcccatgccctgatgctgaacagcgcgcgtgaa
gaggtgcttaagccggtctggcgccagctgatcgataccctgcgcgatctggcgcagcgc
taccgcgatattccgctgatggcgcgcacccatggtcagccggccactccctcgaccgtc
ggcaaagagttcgccaacgtcgcctaccgcctggagcgtcagttccgtcagctgacgcag
gttgagatcctgggcaaaatcaacggcgccgtcggcaactataacgcccatctggccgcc
tacccgcagatcgattggcacgccttcagcgaaagctttgtcacctcgctggggatccag
tggaacccctacaccacccagatcgagccgcacgactatatcgccgagctgtttgactgc
gtcgcccgctttaacaccattctgctcgactttgaccgcgacgtatggggctatatcgcg
ctcaaccacttcaagcagagaaccatcgctggcgaaatcggctcctcgaccatgccgcac
aaggtcaatccgatcgacttcgaaaactccgaaggcaatctgggcctctccaacgccctg
ctgggacacctggcgtccaagctgccggtatcgcgctggcagcgcgatctgaccgactcc
accgtcctgcgcaacctgggggtcggcctcggctacgccctgatcgcctacgcctcgacc
ctcaaagggctgagcaagctggaggtcaaccaggatcatctgctggacgaactggatcac
aactgggagctgctggccgagccggtgcagacggtgatgcgccgctacggtatcgaaaag
ccctatgagaagctcaaggagctgacccgcggcaaacgggtcgacgccgccgggatgcag
cgctttatcgacggtctggcgctgccggaagaggagaaggcgcgcctgaaggccatgacc
ccggccgcgtataccggtgcggccgccgcgctggtcgataaattaaagtaa

DBGET integrated database retrieval system