KEGG   Edwardsiella piscicida C07-087: ETAC_05085Help
Entry
ETAC_05085        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator BaeR
  KO
K07664  two-component system, OmpR family, response regulator BaeR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00450  BaeS-BaeR (envelope stress response) two-component regulatory system
etc_M00646  Multidrug resistance, efflux pump AcrAD-TolC
etc_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_05085
Two-component system [BR:etc02022]
 OmpR family
  BaeS-BaeR [MD:M00450]
   ETAC_05085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF3517
Motif
Other DBs
NCBI-ProteinID: AGH73144
Position
complement(1167414..1168145)
Genome map
AA seq 243 aa AA seqDB search
MNMLATTPLMPEPQGARVLIVEDEPKLGQLLIDYLIAAGYRPHWLNRGDEVLPYLQEHLC
DLILLDLMLPGVDGLTLCREIRRTSEVPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPR
EVVARVKTILRRCGLQDTLSEPAPLLIDESRFQASYRQQPLDLTQAEFRLLKTLATQPGS
VLSREQLLNHLYDDYRVVTDRTVDSHIKNLRRKLEPVEGDEPLIRSVYGVGYRWEGAPCR
IIA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcttgccaccaccccgctgatgcccgaaccgcagggggcgcgcgtcctgatc
gttgaagatgagcccaagctgggccagctgctgatcgactacctgatcgccgccggctat
cgtccccactggctgaaccggggcgacgaggtgttgccctatctgcaggagcatctctgc
gacttgattttgctggatctgatgctgccgggcgtcgacggcctgacgctgtgccgcgag
atccgccgcacctccgaggtgccgatcgtgatggtcaccgccaagatcgaggagatagat
cgcctgctggggctggagatcggcgccgatgactatatttgcaagccctatagcccgcgc
gaggtggtcgcccgagtgaagacgattctgcgccgctgcgggctgcaggataccctctcc
gagccggcgccgctgctcatcgacgaaagccgttttcaggccagctaccgccagcagccg
ctggatctgacccaggcggagttccgtctgctgaagaccctggcgacccagccgggcagc
gtcctctcccgcgaacagctgctcaaccacctgtatgacgactaccgggtggtcaccgac
cgcaccgtcgacagccacatcaaaaatctgcggcgcaagcttgagcctgtcgagggcgac
gagccgctcatccgctcggtgtatggcgtcggctaccgctgggagggagccccctgccgc
atcatcgcctga

DBGET integrated database retrieval system