KEGG   Edwardsiella piscicida C07-087: ETAC_05090Help
Entry
ETAC_05090        CDS       T02509                                 

Definition
(GenBank) signal transduction histidine-protein kinase BaeS
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00450  BaeS-BaeR (envelope stress response) two-component regulatory system
etc_M00646  Multidrug resistance, efflux pump AcrAD-TolC
etc_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_05090
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_05090
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_05090
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_05090
Two-component system [BR:etc02022]
 OmpR family
  BaeS-BaeR [MD:M00450]
   ETAC_05090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA Baculo_PEP_C FlgN betaPIX_CC
Motif
Other DBs
NCBI-ProteinID: AGH73145
Position
complement(1168252..1169625)
Genome map
AA seq 457 aa AA seqDB search
MRLGISAKLFLAILSTCILVLIIMHWGVRVSFERGFIDYIRHGNEQRVQLMASELETLYA
REGNWDFLRHNERMIFRIMRDIEQSSNLHGSLPPHGWRTPFWVIDANGQRLVGPQGSLPS
DGIRSAIRYQGRDVGWVLTTPPERLTRNTDINFDRQQRRTSWFIVALATLLAAAVTLLLS
RGMLAPVKRLINAMHQLAAGNFATRVDVSSRDELGQLAQDFNQLATTLERNEQIRRALMA
DVSHELRTPLAVLRGELEALQDGVRRLTPDSLTSLQAEVSILTKLVNDLHQLSLSDAGAL
AYRKSPIEASALVQAAAGAFRDRLAAKGIRLTLRLPDEAWVFGDPDRLLQLFNNLLENSL
RYTDSGGELQIVGQKRSDTLTLCWQDSAPGVSEEQLQHIFERFYRAEGSRNRASGGSGLG
LSICQNIVAAHGGSLRASHSPLGGVAMTVTLPLEEQT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagactgggcatttccgccaaactctttctggccatcctgtccacctgcattctggtg
ctgatcatcatgcactggggggtgcgcgtcagctttgagcgcggctttatcgactatatc
cgccacggcaatgaacagcgggtacagctgatggccagcgagctggaaaccctgtacgcc
cgcgaaggcaactgggactttctgcgccacaatgagcggatgatctttaggatcatgcgt
gatatcgaacagagcagcaatctgcacggcagcctgcctccccacggctggcgcacccca
ttttgggtcatcgatgccaacgggcagcgcctggtcggcccgcaggggagcctgccgagc
gacggtatccgcagcgcgatacgctatcaggggcgcgacgtcggctgggtgctgacgacc
ccgcccgagcgcctaacgcgcaataccgatattaactttgatcgccagcagcgccgcacc
agctggtttatcgtcgccctggcgaccctgctggcggcggcggtgaccctgctgctatcg
cgcggcatgctggcgccggtcaaacggctgatcaacgccatgcaccagctggccgccggt
aattttgccacccgcgtcgacgtcagcagccgcgacgagctggggcagctggcgcaggac
ttcaatcagttggccaccacgctggagcgcaacgaacagatccgccgggcgctgatggcc
gacgtctcccacgagctgcgcacgccgctggcggtgctgcgcggagagctagaggcgctg
caggatggggtgcgacgcctcacccccgattcactgacctcgctgcaggcggaggtcagc
atcctgaccaagctggtcaacgatctgcaccagctgtcgctctccgacgccggcgccctg
gcctaccgtaaaagccccatcgaggcgagcgccctggtgcaggccgccgccggcgcgttt
cgcgatcggctggccgccaaggggatccgtctgaccctgcggctgccggacgaggcctgg
gtgttcggcgatcccgatcgcctgctgcagctgtttaacaacctcctggaaaatagccta
cgctacaccgatagcggcggcgagctgcagatcgtgggccagaagcgtagcgatacgcta
acgctgtgctggcaggacagcgcgccgggggtcagcgaagagcagctgcagcatatcttt
gagcgcttttaccgcgcggagggctcacgcaaccgcgccagcggaggatcggggctcggg
ctctctatctgccagaatatcgtcgccgcccacggcggcagcctgcgcgccagccactcg
ccgctgggcggcgtcgcgatgaccgtcacgctgccgctggaggagcagacctga

DBGET integrated database retrieval system