KEGG   Edwardsiella piscicida C07-087: ETAC_05095Help
Entry
ETAC_05095        CDS       T02509                                 

Definition
(GenBank) multidrug efflux system subunit MdtC
  KO
K07789  multidrug efflux pump
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_05095
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_05095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF Patched
Motif
Other DBs
NCBI-ProteinID: AGH73146
Position
complement(1169642..1172722)
Genome map
AA seq 1026 aa AA seqDB search
MSGFSLFINRPVATSLLALAITLAGLLGLRLLPVAPLPQVDFPVIMVSASLPGASAETMA
ASVATPLERALGRIAGVNEMTSSSSLGTTRIILQFNLDRNIDGAARDVQAALNAAQSLLP
SGMPSRPSYRKANPSDAPIAILTLTSTQYTQGDLYDLASTRLAQKIAQIDGVGDVSVGGS
SLPAVRIDLSPDALFNQGTSLDTVRQAIANANVRRPLGAVADDEHRWQVQSNDTLMKAQD
YRPLIIRYRDGAPLRLQDVAQISDGVEDVRNAGMSNGQPAILIMIRRSADANIIETVDRL
RSDLPALRALLPSGVSLDIAQERTPTIRASLREVEQSLAIAIGLVILVVFLFLRSARATL
IPAVTVPVSLIGTCAAIYLCGFSLNNLSLMALTIASGFVVDDAIVVLENIARHIENGLSP
RRAALVGVREVGFTVFSISLSLVAVFIPLLFMGGIPGRLFHEFAITLSVSIAISLLIALT
LTPMMCARLLRPRRDDGGGRPTALRRLSALLQRGYARSLSWTLDHARWVLLMLLAVIGLN
IWLYISIPKTFFPQQDTGRLMGFIQADQSISFQAMRGKLQDFMRIVRADPDVENVTGFTG
GARVNSGMMFIALKPLGERKQDAQQVIARLRAKLAHEPGANLFLMAVQDIRAGGRQGNAS
YQYTLLSDDLAVLRHWEPQVRKALAALPQLTDVSTDQQDKGAEMLLTYDRPTMARLGIEV
SEVNSLLNNAFGQRQISTIYQPLNQYHVVMEVDPRYAQDERALDKMFIINQAGQPIPLSG
FASWLPANAPLSVNHQGLSAAATISFNLPPDGSLSDASDAIERAMTALGTPPSLRGTFAG
TALLFQQAQSSQLLLILAAIATVYIVLGMLYESYIHPLTILSTLPSAGVGALLALMLFNA
PFSLIALIGIMLLIGLVKKNAILLVDFALTAEREQHLSARDAIYQACQLRFRPILMTTLA
ALFGALPLAFSYGDGAELRQPLGITIVGGLLVSQILTLYTTPVVYLYMEKLRARVSRQKA
LPPLAH
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttctccctgtttatcaaccgcccggtggccaccagcctgctggcgctggcg
atcaccctggcgggactgctcggcctgcgcctgctgccggtcgccccgctgccgcaggta
gatttcccggtgatcatggtcagtgcctccctgccgggcgcctcggcagagaccatggcc
gcctcggtcgctaccccgctggagcgggcgctggggcgcatcgccggggtcaatgagatg
acctccagcagcagcctgggcacgacccgcatcattttacagttcaatctcgacaggaat
atcgacggcgcggcgcgcgatgtccaggccgcgctgaatgccgcccagagcctgctgccc
tccggcatgccgtcgcgccccagctatcgcaaggccaacccgtccgatgcgcccatcgcg
atcctgacgctgacctcgacgcagtatacccagggggatctctacgatctggcctccacc
cgtctggcgcagaaaatcgcccaaatcgacggcgtcggcgatgtctcggtcggcggcagc
tccctgcccgcggtgcgcatcgatctcagtcccgatgccctgttcaatcagggaacctcg
ctggatacggtgcgccaggccatcgccaacgccaacgtccgccgcccgctgggcgccgtc
gccgatgacgagcaccgctggcaggtgcagagcaacgatacgctgatgaaggcgcaggac
taccgcccgctgatcatccgctaccgcgacggcgcgccgctcaggctgcaggacgtcgcc
cagatcagcgacggcgtcgaggatgtccgcaacgccgggatgagcaacggtcagccggcg
atcctcatcatgatccgccgcagcgccgacgccaatatcatcgaaaccgtcgaccgactg
cgcagcgaccttccggcgctgcgggcgctgctgcccagcggggtctccctggatatcgcc
caggagcgtaccccgaccatccgcgcctccctgcgcgaggtcgagcagtcgctggctatc
gccatcggcctggtgatcctggtggtgttcctgtttctgcgctccgcccgcgccacgctg
atcccggcggtcacggtgccggtttcgcttatcggcacctgcgccgccatctatctgtgc
ggctttagtctgaacaacctgtcgctgatggctctgaccatcgccagcgggtttgtggtg
gacgacgccatcgtggttctggaaaacatcgcccgccacatcgagaatggcctgagcccc
cgccgcgccgcgctggtcggcgtgcgcgaggtgggctttaccgtcttctccatcagtctg
tcgctggtcgccgtctttattccgctgctgtttatgggcggcattcccgggcgcctgttt
catgagttcgccatcacgctgtcggtctccatcgccatctcgctgctgatcgcgctgacc
ctgacgccgatgatgtgcgcccgcctgctgcggccgcgccgcgacgacggcgggggacgc
ccgaccgccctacgccgcctatcggcgctgctacagcggggctatgcccgctccctgagc
tggacgctggaccacgcccgctgggtcttgctgatgctgctggcggtgatcggattaaac
atctggctgtatatcagcattccaaaaacctttttcccccagcaggataccgggcggctg
atgggctttattcaggccgatcagagcatctcgtttcaggccatgcgcggtaagctacag
gactttatgcgcatcgtacgcgccgatcccgacgtagaaaacgtcaccggcttcaccggc
ggcgcccgcgtcaacagcggaatgatgtttatcgcccttaagccgctgggcgagcggaaa
caggatgcccaacaggtcatcgcccgtctgcgcgctaagctggcccatgaaccgggcgcg
aacctgtttctgatggcggtgcaggatattcgagcgggaggtcgccagggcaacgccagc
tatcagtacaccctgctgtcggacgatctcgccgtcctgcgccactgggagccgcaggta
cgcaaggcgctcgccgccctgccccagctgaccgatgtcagcaccgatcagcaggacaag
ggggcagagatgctgctgacctacgatcgcccgaccatggcgcggctggggatcgaggtc
agcgaggtcaactcgctgctgaacaatgcctttggccaacgccaaatctccaccatctac
cagccgcttaaccaataccacgtggtgatggaggtcgatccgcgctacgcccaggatgag
cgggcgctggataagatgtttatcatcaaccaggccgggcagccgatcccgctgtccggg
ttcgccagctggctgccggccaacgcgccgctgtcggttaaccatcaggggctgagcgcc
gcggccaccatctccttcaacctgccgccggacggctcgctctccgacgccagcgacgcc
atcgagcgtgccatgaccgccctgggcaccccgccctctctgcgcggcacctttgccggc
accgccctgctgtttcagcaggcgcagagcagccagctgctcctgatcctggccgccatc
gccacggtctatatcgtgctgggcatgctgtatgaaagctatattcatccgctgaccatc
ctgtcgaccctgccgtcggccggggtcggcgccctgctggcgctgatgctgttcaacgcg
cccttcagcctgatcgcgctgatcggcatcatgctgctgatagggctggtgaagaaaaac
gccattctgctggtcgactttgccctgacggcggagcgagagcagcacctgagcgcccgc
gacgccatctatcaggcctgtcagctgcgctttcgcccgattctgatgaccaccctggcc
gccctgttcggcgcgctgccgctggccttcagctacggcgacggcgccgagctgcgtcag
ccgctgggcatcaccatcgtcggcggcctgctggtcagccagatcctgacgctgtacacc
accccggtggtctacctgtatatggagaagctgcgtgcccgcgtcagtcgacagaaagcc
ctgccgccgctggcgcactga

DBGET integrated database retrieval system