KEGG   Edwardsiella piscicida C07-087: ETAC_05105Help
Entry
ETAC_05105        CDS       T02509                                 

Definition
(GenBank) Putative RND efflux membrane fusion protein
  KO
K07799  membrane fusion protein, multidrug efflux system
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_05105
Transporters [BR:etc02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   ETAC_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_D23 HlyD_3 Biotin_lipoyl BMFP PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AGH73148
Position
complement(1175844..1177070)
Genome map
AA seq 408 aa AA seqDB search
MSVISALSSRRAKLCGLLILLLLLGAFAWHHVSSAPPADAGGSPARQRDARPGRGMAQTV
PVQAAVVHRAAQDSYLSGLGTVTASNTVTVRSRVDGQLMKLHFTEGQQVKAGDLLAEIDP
RPFQIQLQQAQGALARDTAMLDNARRDLVRYQRLAKDNLVSRQELDTQASLVAQTQASLV
SDRANVDSAQLQLDYSRIRAPGDGRAGLRQVDEGNYISSADTNGLVVLTQTHPIDVLFTL
PEGDIPRLQQALQRQGTLVAEAWDRSDRQRLATGHLLSLDNQIDTATGTLKIKARFDNQD
DRLFPNQFVNLRLQVASQAPVLLVPAAAVQTGREGRFVWVVDAENRVHKRSLSVGARDGD
ALVVQQGVNAGDKVVTDGIDRLTEGGQVDIITAQRPDAAADHGDTPQP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatatccgcactatcttcccggcgcgccaagctctgcgggctgttaattctg
ctgctcctgctgggcgcgttcgcctggcatcacgtctcctctgcgccgcccgccgacgcc
ggcggaagcccggcgcgccagcgcgacgctagaccgggacgcggcatggcgcagacggtt
cccgtgcaggcggcggtcgtgcaccgcgccgcgcaggacagctacctcagcgggctgggc
accgtcaccgcctccaataccgtgaccgtgcgcagccgggtcgatggccagctgatgaag
ctgcacttcacggaggggcagcaggtgaaggccggcgatctgctggctgaaatcgaccca
cgcccgttccagatccagctgcagcaggcccagggagcgctggcgcgcgatacggcgatg
ctggacaacgcccgacgcgatctggtgcgctaccagcgcctcgccaaagataatttggtc
tcgcgtcaggagctggatacccaggcttcgctggtcgcccagacgcaggccagcctggtc
agcgatcgggccaacgtggatagcgcccagctgcagctggactacagtcgtatccgggcg
ccgggcgatggccgcgccggtcttcgtcaggtcgatgagggcaactatatcagcagcgcg
gataccaatggcttggtggtgctgacccaaacccaccccatcgacgtgctgttcacccta
cctgagggggatattccccgcctgcagcaggcgctgcagcgccagggaacgctggttgcc
gaagcctgggatcgcagcgatcgccagcgcctggcgaccggccatctgctcagcctggac
aaccagatagacaccgcgaccggaaccctgaagatcaaggcccgcttcgataatcaggac
gatcgcctgttccccaatcagttcgtcaacctgcgcctgcaggtcgccagccaggcgccg
gtgctgctggttcccgcggcggcggtacagaccggccgtgaagggcgctttgtctgggtg
gtcgacgccgagaacagggtgcataagcgcagcctcagcgtcggcgcgcgcgacggcgac
gcgctggtggtacaacagggggtcaacgcgggcgacaaggtggtaaccgacggcatcgat
cggctgacggagggggggcaggtcgacatcatcaccgctcagcgccctgacgccgccgcg
gaccacggggataccccgcagccatga

DBGET integrated database retrieval system