KEGG   Edwardsiella piscicida C07-087: ETAC_05160Help
Entry
ETAC_05160        CDS       T02509                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor protein
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05160 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_05160 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_05160 (phoR)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_05160 (phoR)
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_05160 (phoR)
Two-component system [BR:etc02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   ETAC_05160 (phoR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoR HATPase_c HisKA PAS HATPase_c_2 PAS_8 HATPase_c_3 PAS_4 PAS_9 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH73157
Position
1186972..1188273
Genome map
AA seq 433 aa AA seqDB search
MLDKLSWKTLLSELLLCCVPALLLGALFGYLPWFLLSALCLLLLWHGWNQLRLSHWLWVD
RSMTPPSGRGSWEPLFYGLYQMQQRNRRRRRELALLIKRFRSGAESLPDAIVMLTDEGNI
FWCNHLAQHLLGFRWPEDNGQNIRNLLRYPEFSRYLGDADYARPLTLHLNSGRYMEFRLM
PYSEGQMLMIARDVTQKRQLEGARRNFFANVSHELRTPLTVLQGYLEMFGDDAMPAPQRE
KALLTMQAQAQRMDGLVRQLLVLSRIEAAPDIDLSAVVDVPAMLHMLEREANALSDGQHT
LRFSIDDGLRVRGNEEQLRSAVSNLVYNAINHTPAGTQIRVCWQRTAQGAYFSVQDNGPG
IAQEHLSHLTERFYRVDRSRSSRTGGSGLGLAIVKHALQHHEAQLAIDSALGQGTRFAFT
LPSHLVFNGTPSA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgctagataaactctcctggaagacgctgctgtctgagctgctgctgtgctgcgtgccg
gcgctgctgctcggcgcgctgttcggctatttaccctggtttttactgtcggcgctgtgc
ctgctgctgctgtggcacggctggaatcagctgcggctctcccactggctgtgggtggat
cgcagcatgacgccgcccagcgggcgcggcagctgggagccgctgttttacgggctgtat
cagatgcagcagcgcaatcggcggcggcggcgtgagctggctttgctgatcaaacgcttc
cgcagcggggcggagtcgctgcccgatgccatcgtgatgctgaccgatgagggcaacatc
ttttggtgtaaccatctggcgcagcatctgctggggttccgctggccggaggataatggg
cagaatatccgcaatctgctgcgctatcccgaatttagccgctatctgggcgacgccgac
tacgctcggccgctgacgctgcacctgaacagcgggcgctatatggagtttcgcctgatg
ccctacagcgaggggcagatgctgatgatcgcgcgcgatgtgacccaaaagcgtcagttg
gagggcgcgcggcgcaacttttttgccaacgtcagccatgagctgcgcacgccgctgacg
gtgctgcagggctatctggagatgtttggcgacgatgccatgccggcgccgcagcgggag
aaggcgctgctgaccatgcaggcgcaggcgcagcgtatggatggactggttcggcagctg
ctggtgctgtcgcggattgaggcggcgccggacatcgatctcagcgcggtggtcgatgtc
ccggcgatgctgcatatgctggagcgcgaggccaacgcgctgagcgacggccagcacacg
ctacgctttagcattgatgatggcctgcgggtgcgcggcaacgaggagcagctgcgcagc
gccgtctctaacctggtgtataacgcgatcaaccatacgccggcgggaacgcagattagg
gtatgctggcagcgcaccgcgcagggggcctactttagcgtgcaggacaatgggccgggc
atcgctcaggagcacctcagccatctgaccgagcgcttttaccgggtcgaccgctcccgc
tctagccgcaccggcggcagcgggctgggactggccatcgtcaagcatgcgctgcagcac
cacgaggcgcagctggcgatcgatagcgctctcgggcagggaacccgcttcgcgtttacc
ctgccgtcccatctggtgttcaacggcacaccgtcggcctga

DBGET integrated database retrieval system