KEGG   Edwardsiella piscicida C07-087: ETAC_05180Help
Entry
ETAC_05180        CDS       T02509                                 

Definition
(GenBank) Phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_05180
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_05180
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     ETAC_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N DUF1412
Motif
Other DBs
NCBI-ProteinID: AGH73161
Position
complement(1192749..1193387)
Genome map
AA seq 212 aa AA seqDB search
MKRIVVLISGQGSNLQALIDACAAGRIPGRIVAVFSNRADAHGLARARRAGIDACALCAD
DYPDRQAFDMALAAQIAAYHPDLLVLAGYMRILSPAFVHRFAGRMLNVHPSLLPRYPGLD
THRRARDNGDTQHGASVHFVSDALDGGPVVLQAQVPIFADDSVAEIAARVQVQEHAIYPL
AVAWFCSDRLRQRDGLAWLDGQALPPQGYASD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtatcgtcgtgctgatctccggccaaggcagcaatctgcaggcgctgatcgac
gcctgcgccgccggacggattccagggcgcatcgtcgccgttttcagcaaccgcgccgac
gcccacggactggcgcgcgcgcgccgagccggcattgacgcgtgcgccctgtgtgcggat
gactaccccgaccgccaggccttcgacatggcgctggcggcgcagatcgccgcctatcac
cctgaccttctggtgctggccggctatatgcgcatcctctcgccggcctttgtccatcgc
ttcgccgggcgcatgctcaacgttcacccctcgctgctgccgcgctaccccggtctggat
acccaccgccgggcccgggacaatggcgatacccagcacggcgcctccgttcactttgtc
agcgacgcgctggacggcggtccggtggtgctgcaggcccaggtaccgatcttcgccgac
gacagcgtcgccgagatcgccgctcgggtgcaggtacaggagcacgccatctatccgctg
gcggtcgcctggttctgcagcgatcgtctacgacagcgcgacggtctggcctggctggac
ggacaggcgctgccgccgcaggggtacgccagcgattag

KEGG   Edwardsiella piscicida C07-087: ETAC_08420Help
Entry
ETAC_08420        CDS       T02509                                 

Definition
(GenBank) Phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_08420
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_08420
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     ETAC_08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Epimerase 2-Hacid_dh_C ATP-grasp_3 LAL_C2 RmlD_sub_bind 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGH73805
Position
1915965..1917143
Genome map
AA seq 392 aa AA seqDB search
MQPIGTALRPHATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMQVAHRSHVID
MRDGDSLRALIERERPDYIVPEIEAIATQTLLQLESDGQRVVPCARAVQLTMNREGIRRL
AAETLALPTSPYRFADSIEAFRQAVAEIGYPCFVKPVMSSSGKGQSIVRGDDDVASAWQY
ARQGARGDADSVIVEGEVRFDFEITLLTVQASDGIHFCAPIGHRQQEGDYRESWQPQAMS
PAALARAQAIAASVVRALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGLVTLVSQDLSEF
ALHVRAFLGLPIGVIRQFGPSASAVLLPSLHSDDVTFANLSQALRPATQLRLFGKPHIDG
VRRLGVALAWGESTETARQRARDSAASVVIRP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaatcggaaccgcccttcgtccccatgcaacccgcgtcatgctgttaggcgcc
ggtgagctcggcaaagaggtcgctattgagtgtcagcgtctcggtctggaagtgattgcc
gtggatcgctatgccgatgcgccggccatgcaggtcgcccaccgtagccacgtcatcgat
atgcgcgacggcgacagcctgcgggcgcttatcgaacgcgagcgccctgactatatcgtg
ccggaaatcgaggccatcgcaacgcaaacgctgctgcagctggagagcgacggccaacgc
gtcgttccctgcgctcgggcagtacagctcacgatgaaccgcgaagggatccgccgcctg
gcggccgagaccctggcgctgcccacctccccctatcgctttgccgatagcatcgaggcg
tttcgccaggcggtggccgagatcggctatccctgcttcgtcaagcccgtcatgagttca
tcgggtaagggacagagcatcgtgcgcggcgacgacgacgtggcgtccgcctggcaatac
gcccgccagggagcccgcggtgacgccgacagcgtcatcgtagagggtgaggtccgcttc
gatttcgagataaccctgttgaccgtacaggccagcgacgggatccacttctgcgcgccg
atcgggcaccgccagcaggagggcgactaccgcgagtcctggcagccgcaggcgatgagc
cctgccgcgctggcgcgggcgcaggcgatcgccgcctcggtcgtccgggcgctgggggga
tatggtctgtttggcgtagagctgtttgtctgcggcgacgaggtgatcttcagcgaggtc
tccccccgcccccacgataccgggctggtcacgctggtctcgcaggatctctctgagttt
gcgctgcatgtccgcgcgtttctcgggctgccgatcggcgtgatccgccagtttggcccc
agcgcatccgccgtactgctgccgtcgctgcacagcgacgacgttaccttcgccaatctc
tcgcaggcgctgcgcccggcaacccagctgcgcctgtttggcaagccgcacatcgacggc
gtgcggcgcctcggcgtcgcgctggcctggggagagagtacggaaacggcgcgccagcgc
gccagggacagcgcggcgtcggtggttatccgcccctaa

DBGET integrated database retrieval system