KEGG   Edwardsiella piscicida C07-087: ETAC_05185Help
Entry
ETAC_05185        CDS       T02509                                 

Definition
(GenBank) Phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_05185
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     ETAC_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AGH73162
Position
complement(1193399..1194442)
Genome map
AA seq 347 aa AA seqDB search
MTDKTALSYKDAGVDIDAGNALVDRIKGVVKETRRPEVMGGLGGFGALCALPQKYREPVL
VSGTDGVGTKLRLAMDLQRHDSIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAA
SVIGGIAAGCKQAGCALVGGETAEMPGMYHGEDYDVAGFCVGVVEKSQIIDGSQVRPGDA
LIALAASGPHSNGYSLIRKILEVSGCDPRTTMLAGRPLADHLLAPTRIYVAACLDLIASH
EVHALAHLTGGGFWENIPRVLPAGAKAVIDEGSWQWPAVFDWLQQTGNVSRREMYRTFNC
GVGMVIVLPQAQVDSALARLSQSGEQAWLLGHIAEAQGDEPQVEILR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaaaaccgctctcagttacaaagacgccggcgtagacattgatgctggcaac
gctttggttgaccgaattaaaggcgtcgtcaaagagacccgccgacctgaagtgatgggc
ggcctgggcggcttcggcgcactgtgcgcgctgccgcaaaaataccgtgagccggtgctg
gtctccggtaccgacggcgtcggcaccaagctgcgtctggcaatggatctgcagcgccac
gacagcatcggtatcgatctggtggccatgtgcgtcaacgacctggtggttcagggcgcc
gagccgctatttttcctggattactacgccaccggcaagctcgacgtcgataccgcggcg
agcgtcatcggcgggatcgcggcgggctgtaaacaggccggctgtgcgctggtgggcggg
gaaaccgccgaaatgcccggcatgtaccacggcgaagactacgacgtggccggattctgc
gtcggcgtggtcgagaagtcccagattatcgacggcagccaggtgcgccccggcgatgcc
ctgatcgccctggccgccagcgggccacactccaacggctactcgctgatccgcaagatc
ctggaggtcagcggctgcgatccgcgcacgaccatgctggccgggcgcccgctggccgac
cacctgctggcgccgacccgtatctacgtcgccgcctgtctggatctgatcgccagccat
gaggtgcacgccctcgcccacctcaccggcggcggcttctgggagaacattccgcgcgtg
ctgccggccggcgccaaggccgtcatcgacgaaggcagctggcagtggccggccgtcttc
gactggctgcagcagaccggcaacgtcagccgccgcgaaatgtaccgcacctttaactgc
ggcgtcgggatggtaatcgtcctgccgcaggcacaggtcgactccgcgctggcgcgcctg
agccaatccggcgaacaggcctggctgctgggccatatcgctgaggcgcagggcgacgag
ccgcaggtcgagatcctgcgctga

DBGET integrated database retrieval system